[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56911.1

[Show Plain Result]


## Summary of Sequence Search
    1::191
    1::191     5e-74  70%  194 aa  XPT_CLOPH RecName: Full=Xanthine phosphoribosyltransferase;        
    1::192     7e-70  70%  193 aa  XPT_BIFLO RecName: Full=Xanthine phosphoribosyltransferase;        
    1::192     7e-70  70%  193 aa  XPT_BIFLD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::192     1e-69  70%  193 aa  XPT_BIFAA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::192     2e-69  70%  193 aa  XPT_BIFLI RecName: Full=Xanthine phosphoribosyltransferase;        
    1::192     1e-60  65%  193 aa  XPT_BIFA0 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     5e-58  57%  190 aa  XPT_CLOCE RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     4e-56  58%  190 aa  XPT_CLONN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::183     4e-53  52%  190 aa  XPT2_CLOBL RecName: Full=Xanthine phosphoribosyltransferase 2;     
    1::183     5e-53  52%  190 aa  XPT2_CLOBH RecName: Full=Xanthine phosphoribosyltransferase 2;     
    1::183     5e-53  52%  190 aa  XPT2_CLOB1 RecName: Full=Xanthine phosphoribosyltransferase 2;     
    1::188     4e-52  55%  195 aa  XPT_LACSS RecName: Full=Xanthine phosphoribosyltransferase;        
    1::185     2e-50  54%  202 aa  XPT_ALKMQ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::190     1e-49  52%  190 aa  XPT_CLOD6 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     4e-49  54%  189 aa  XPT_PSE14 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::179     4e-49  54%  190 aa  XPT_FINM2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     7e-49  51%  192 aa  XPT_LACCB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     7e-49  51%  192 aa  XPT_LACC3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::183     7e-49  54%  201 aa  XPT_BACSK RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     9e-49  54%  189 aa  XPT_PSEU2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     9e-49  52%  190 aa  XPT_PSEPK RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     9e-49  52%  190 aa  XPT_PSEPG RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     9e-49  52%  190 aa  XPT_PSEP1 RecName: Full=Xanthine phosphoribosyltransferase;        
    7::181     9e-49  54%  196 aa  XPT_MOOTA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-48  54%  189 aa  XPT_PSESM RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     2e-48  52%  190 aa  XPT_PSEE4 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::190     3e-48  49%  190 aa  XPT_CLOTE RecName: Full=Xanthine phosphoribosyltransferase;        
    1::185     4e-48  52%  194 aa  XPT_OCEIH RecName: Full=Xanthine phosphoribosyltransferase;        
    1::183     5e-48  52%  190 aa  XPT_LARHH RecName: Full=Xanthine phosphoribosyltransferase;        
    1::185     8e-48  52%  193 aa  XPT_ENTFA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-47  51%  190 aa  XPT_PSEAE RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-47  51%  190 aa  XPT_PSEAB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-47  51%  190 aa  XPT_PSEA8 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     1e-47  51%  192 aa  XPT_LACS1 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     3e-47  51%  190 aa  XPT_PSEA7 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     4e-47  53%  190 aa  XPT_PSEU5 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     5e-47  54%  188 aa  XPT_BACV8 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     5e-47  50%  191 aa  XPT_ACIAD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     7e-47  51%  191 aa  XPT_ACIBT RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     7e-47  51%  191 aa  XPT_ACIBC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     7e-47  51%  191 aa  XPT_ACIB5 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     7e-47  51%  191 aa  XPT_ACIB3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     9e-47  51%  197 aa  XPT_BACCN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     2e-46  47%  191 aa  XPT_LACBA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     6e-46  50%  193 aa  XPT_STRPS RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-45  51%  190 aa  XPT_PSEPF RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-45  51%  190 aa  XPT_PSEF5 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     1e-45  49%  193 aa  XPT_STRZT RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     1e-45  51%  193 aa  XPT_STRSV RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-45  50%  190 aa  XPT_PSEFS RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRZJ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRR6 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRPJ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRPI RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRP7 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRP4 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRP2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     2e-45  50%  193 aa  XPT_STRA5 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     2e-45  50%  193 aa  XPT_STRA3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     2e-45  50%  193 aa  XPT_STRA1 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-45  49%  193 aa  XPT_STRZP RecName: Full=Xanthine phosphoribosyltransferase;        
    1::179     2e-45  51%  198 aa  XPT_BACHD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     5e-45  49%  193 aa  XPT_STRPN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     5e-45  49%  193 aa  XPT_STRGC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     6e-45  51%  193 aa  XPT_STRU0 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     6e-45  51%  195 aa  XPT_LACPL RecName: Full=Xanthine phosphoribosyltransferase;        
    1::184     8e-45  48%  196 aa  XPT_BREBN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     8e-45  51%  190 aa  XPT1_CLOBL RecName: Full=Xanthine phosphoribosyltransferase 1;     
    1::188     1e-44  49%  190 aa  XPT_PSEMY RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-44  53%  194 aa  XPT_BACLD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     2e-44  51%  192 aa  XPT_STAAR RecName: Full=Xanthine phosphoribosyltransferase;        
    1::183     2e-44  48%  190 aa  XPT1_CLOPS RecName: Full=Xanthine phosphoribosyltransferase 1;     
    1::183     2e-44  48%  190 aa  XPT1_CLOPE RecName: Full=Xanthine phosphoribosyltransferase 1;     
    1::183     2e-44  48%  190 aa  XPT1_CLOP1 RecName: Full=Xanthine phosphoribosyltransferase 1;     
    1::188     4e-44  49%  194 aa  XPT_BACA2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     5e-44  49%  194 aa  XPT_EXIS2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     9e-44  52%  193 aa  XPT_STAS1 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     9e-44  52%  192 aa  XPT_STAES RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     9e-44  52%  192 aa  XPT_STAEQ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     9e-44  51%  192 aa  XPT_STACT RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAW RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAT RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAS RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAM RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAE RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAAB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAA9 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAA8 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAA3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAA2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-44  51%  192 aa  XPT_STAA1 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-43  52%  192 aa  XPT_LISMO RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-43  52%  192 aa  XPT_LISMF RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     2e-43  49%  190 aa  XPT1_CLOBH RecName: Full=Xanthine phosphoribosyltransferase 1;     
    1::181     2e-43  49%  190 aa  XPT1_CLOB1 RecName: Full=Xanthine phosphoribosyltransferase 1;     
    1::181     3e-43  48%  190 aa  XPT_CLOB8 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     5e-43  52%  192 aa  XPT_LISMC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     6e-43  49%  194 aa  XPT_MACCJ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     1e-42  44%  190 aa  XPT_PEDPA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     1e-42  46%  197 aa  XPT_LACLM RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     1e-42  50%  193 aa  XPT_STAHJ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     1e-42  45%  197 aa  XPT_LACLS RecName: Full=Xanthine phosphoribosyltransferase;        
    1::184     1e-42  47%  193 aa  XPT_EXISA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     2e-42  49%  189 aa  XPT_BACFR RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     2e-42  49%  189 aa  XPT_BACFN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     4e-42  45%  197 aa  XPT_LACLA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     7e-42  48%  194 aa  XPT_BACSU RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-41  49%  194 aa  XPT_GEOTN RecName: Full=Xanthine phosphoribosyltransferase;        
    9::196     3e-41  44%  206 aa  XPT_OENOB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-41  45%  192 aa  XPT_EUBR3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     6e-41  47%  192 aa  XPT_STRTR RecName: Full=Xanthine phosphoribosyltransferase;        
    1::192     7e-41  43%  192 aa  XPT2_CLOPS RecName: Full=Xanthine phosphoribosyltransferase 2;     
    1::192     7e-41  43%  192 aa  XPT2_CLOPE RecName: Full=Xanthine phosphoribosyltransferase 2;     
    1::192     7e-41  43%  192 aa  XPT2_CLOP1 RecName: Full=Xanthine phosphoribosyltransferase 2;     
    1::181     9e-41  48%  188 aa  XPT_PARD8 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     2e-40  47%  190 aa  XPT_BACTN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-40  45%  189 aa  XPT_LEUMM RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     6e-40  45%  197 aa  XPT_BACC2 RecName: Full=Xanthine phosphoribosyltransferase;        
    2::161     1e-39  51%  162 aa  XPT_STRMT RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-39  44%  191 aa  XPT_LACRJ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     1e-39  44%  191 aa  XPT_LACRD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::185     2e-39  45%  197 aa  XPT_BACWK RecName: Full=Xanthine phosphoribosyltransferase;        
    1::185     2e-39  45%  197 aa  XPT_BACCR RecName: Full=Xanthine phosphoribosyltransferase;        
    1::185     2e-39  45%  197 aa  XPT_BACC1 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  47%  193 aa  XPT_STRE4 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  45%  197 aa  XPT_BACHK RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  45%  197 aa  XPT_BACCQ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  45%  197 aa  XPT_BACC7 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  45%  197 aa  XPT_BACC0 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  45%  197 aa  XPT_BACAN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  45%  197 aa  XPT_BACAC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     3e-39  45%  197 aa  XPT_BACAA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     4e-39  45%  197 aa  XPT_BACCZ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::185     4e-39  44%  197 aa  XPT_BACC4 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     5e-39  46%  193 aa  XPT_STRS7 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     7e-39  45%  189 aa  XPT_LACDB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     7e-39  45%  189 aa  XPT_LACDA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::178     1e-38  44%  192 aa  XPT_LACAC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-38  46%  197 aa  XPT_BACC3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-38  46%  197 aa  XPT_BACAH RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-38  47%  190 aa  XPT_AZOVD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     7e-38  46%  193 aa  XPT_PORGI RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     7e-38  46%  193 aa  XPT_PORG3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::189     2e-37  41%  195 aa  XPT_LACF3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::187     5e-37  45%  188 aa  XPT_HELMI RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-36  40%  192 aa  XPT_LACH4 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::186     4e-36  41%  193 aa  XPT_DEIRA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     5e-36  45%  194 aa  XPT_BACP2 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::184     7e-36  44%  192 aa  XPT_LISW6 RecName: Full=Xanthine phosphoribosyltransferase;        
    3::180     1e-35  45%  188 aa  XPT_DESRM RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     2e-35  43%  193 aa  XPT_STRPG RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-35  45%  192 aa  XPT_LISIN RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRPM RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRPF RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRPD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRPC RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRPB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRP8 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRP6 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRP3 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     3e-35  43%  193 aa  XPT_STRP1 RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     1e-34  43%  193 aa  XPT_STRPZ RecName: Full=Xanthine phosphoribosyltransferase;        
    1::186     2e-32  40%  202 aa  XPT_DEIGD RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     5e-32  38%  193 aa  XPT_DEIDV RecName: Full=Xanthine phosphoribosyltransferase;        
    1::188     7e-31  39%  192 aa  XPT_LACJO RecName: Full=Xanthine phosphoribosyltransferase;        
    1::182     9e-31  39%  192 aa  XPT_LACGA RecName: Full=Xanthine phosphoribosyltransferase;        
    1::181     3e-30  41%  189 aa  XPT_CLOAB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     1e-29  41%  190 aa  XPT_CLOBB RecName: Full=Xanthine phosphoribosyltransferase;        
    1::176     2e-29  41%  190 aa  XPT_CLOBA RecName: Full=Xanthine phosphoribosyltransferase;        
   15::190     2e-19  34%  211 aa  XPT_CHLSY RecName: Full=Xanthine phosphoribosyltransferase;        
   15::190     2e-19  34%  211 aa  XPT_CHLAA RecName: Full=Xanthine phosphoribosyltransferase;        
   95::234     1e-15  33%  285 aa  PURR_BACSU RecName: Full=Pur operon repressor;
  118::257     2e-12  27%  275 aa  PURR_STRR6 RecName: Full=Pur operon repressor;
  118::257     2e-12  27%  275 aa  PURR_STRPN RecName: Full=Pur operon repressor;
   44::163     2e-11  34%  171 aa  APT_DESMR RecName: Full=Adenine phosphoribosyltransferase;       
   50::177     6e-11  31%  183 aa  APT_META3 RecName: Full=Adenine phosphoribosyltransferase;       
   51::178     8e-11  30%  185 aa  APT1_METVS RecName: Full=Adenine phosphoribosyltransferase 1;      
   51::178     1e-10  32%  185 aa  APT1_METM7 RecName: Full=Adenine phosphoribosyltransferase 1;      
   51::178     2e-10  31%  185 aa  APT2_METM5 RecName: Full=Adenine phosphoribosyltransferase 2;      
   51::178     2e-10  30%  185 aa  APT1_METMP RecName: Full=Adenine phosphoribosyltransferase 1;      
  116::236     2e-10  27%  271 aa  PURR_LACLM RecName: Full=Pur operon repressor;
  116::236     2e-10  27%  271 aa  PURR_LACLA RecName: Full=Pur operon repressor;
    9::163     7e-09  32%  182 aa  APT_STRGB RecName: Full=Adenine phosphoribosyltransferase;       
   29::169     7e-09  28%  175 aa  APT_PELUB RecName: Full=Adenine phosphoribosyltransferase;       
    7::161     1e-08  30%  178 aa  APT_STRCL RecName: Full=Adenine phosphoribosyltransferase;       
   58::160     2e-08  33%  182 aa  APT_STRCO RecName: Full=Adenine phosphoribosyltransferase;       
    2::181     2e-08  29%  193 aa  APT_METTM RecName: Full=Adenine phosphoribosyltransferase;       
   54::169     2e-08  30%  183 aa  APT_METJA RecName: Full=Adenine phosphoribosyltransferase;       
   64::170     2e-08  33%  185 aa  APT_NOCSJ RecName: Full=Adenine phosphoribosyltransferase;       
   35::166     4e-08  33%  172 aa  APT_HERA2 RecName: Full=Adenine phosphoribosyltransferase;       
   54::179     5e-08  30%  189 aa  APT_HALMA RecName: Full=Adenine phosphoribosyltransferase;       
   38::159     5e-08  30%  170 aa  APT_DESAD RecName: Full=Adenine phosphoribosyltransferase;       
   56::178     6e-08  31%  193 aa  APT_METTH RecName: Full=Adenine phosphoribosyltransferase;       
    9::160     8e-08  30%  182 aa  APT_STRAW RecName: Full=Adenine phosphoribosyltransferase;       
   52::181     8e-08  29%  183 aa  APT_SHEPA RecName: Full=Adenine phosphoribosyltransferase;       
   16::158     1e-07  26%  190 aa  APT_TREDE RecName: Full=Adenine phosphoribosyltransferase;       
   52::181     2e-07  28%  183 aa  APT_SHEHH RecName: Full=Adenine phosphoribosyltransferase;       
   38::159     2e-07  28%  171 aa  APT_BACHD RecName: Full=Adenine phosphoribosyltransferase;       
   45::168     3e-07  35%  171 aa  APT_NITOC RecName: Full=Adenine phosphoribosyltransferase;       
   54::174     4e-07  29%  180 aa  APT_MARMS RecName: Full=Adenine phosphoribosyltransferase;       
   49::173     5e-07  35%  174 aa  APT_NITEU RecName: Full=Adenine phosphoribosyltransferase;       
   35::167     5e-07  32%  172 aa  APT_CLOPS RecName: Full=Adenine phosphoribosyltransferase;       
   35::167     5e-07  32%  172 aa  APT_CLOPE RecName: Full=Adenine phosphoribosyltransferase;       
   35::167     5e-07  32%  172 aa  APT_CLOP1 RecName: Full=Adenine phosphoribosyltransferase;       
    5::168     5e-07  25%  180 aa  APT_ACTSZ RecName: Full=Adenine phosphoribosyltransferase;       
   31::169     9e-07  28%  172 aa  APT_LACBA RecName: Full=Adenine phosphoribosyltransferase;       
   46::179     1e-06  27%  181 aa  APT_SHELP RecName: Full=Adenine phosphoribosyltransferase;       
   25::178     1e-06  27%  186 aa  APT_DEBHA RecName: Full=Adenine phosphoribosyltransferase;       
   38::153     2e-06  30%  180 aa  APT_PASMU RecName: Full=Adenine phosphoribosyltransferase;       
   52::172     2e-06  31%  183 aa  APT_KLEP7 RecName: Full=Adenine phosphoribosyltransferase;       
   31::161     2e-06  30%  170 aa  APT_BACSU RecName: Full=Adenine phosphoribosyltransferase;       
   31::159     2e-06  31%  170 aa  APT_BACA2 RecName: Full=Adenine phosphoribosyltransferase;       
   31::175     2e-06  30%  176 aa  APT_LEUMM RecName: Full=Adenine phosphoribosyltransferase;       
   48::163     2e-06  28%  172 aa  APT_LACPL RecName: Full=Adenine phosphoribosyltransferase;       
   54::176     2e-06  28%  188 aa  APT_HALWD RecName: Full=Adenine phosphoribosyltransferase;       
   54::153     2e-06  29%  188 aa  APT_HALSA RecName: Full=Adenine phosphoribosyltransferase;       
   54::153     2e-06  29%  188 aa  APT_HALS3 RecName: Full=Adenine phosphoribosyltransferase;       
   42::175     2e-06  29%  179 aa  APT_ACTPJ RecName: Full=Adenine phosphoribosyltransferase;       
   42::175     2e-06  29%  179 aa  APT_ACTP7 RecName: Full=Adenine phosphoribosyltransferase;       
   42::175     2e-06  29%  179 aa  APT_ACTP2 RecName: Full=Adenine phosphoribosyltransferase;       
   55::176     3e-06  32%  176 aa  APT_THEFY RecName: Full=Adenine phosphoribosyltransferase;       
   36::161     3e-06  29%  174 aa  APT_MAGSA RecName: Full=Adenine phosphoribosyltransferase;       
   56::167     3e-06  33%  172 aa  APT_STACT RecName: Full=Adenine phosphoribosyltransferase;       
   50::179     3e-06  28%  181 aa  APT_SHEWM RecName: Full=Adenine phosphoribosyltransferase;       
   55::154     3e-06  28%  172 aa  APT_PROM4 RecName: Full=Adenine phosphoribosyltransferase;       
   38::169     3e-06  32%  174 aa  APT_NITEC RecName: Full=Adenine phosphoribosyltransferase;       
   56::161     4e-06  29%  172 aa  APT_STAES RecName: Full=Adenine phosphoribosyltransferase;       
   56::161     4e-06  29%  172 aa  APT_STAEQ RecName: Full=Adenine phosphoribosyltransferase;       
   57::178     4e-06  32%  182 aa  APT_SHEFN RecName: Full=Adenine phosphoribosyltransferase;       
   52::172     4e-06  30%  183 aa  APT_KLEP3 RecName: Full=Adenine phosphoribosyltransferase;       
   30::162     4e-06  28%  171 aa  APT_GEOSM RecName: Full=Adenine phosphoribosyltransferase;       
   30::162     4e-06  28%  171 aa  APT_GEOBB RecName: Full=Adenine phosphoribosyltransferase;       
   54::179     4e-06  31%  185 aa  APT_ERWCT RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACWK RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACHK RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACCZ RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACCR RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACCQ RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACC7 RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACC4 RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACC2 RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACC1 RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACC0 RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACAN RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACAH RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACAC RecName: Full=Adenine phosphoribosyltransferase;       
   56::155     4e-06  36%  170 aa  APT_BACAA RecName: Full=Adenine phosphoribosyltransferase;       
   52::179     6e-06  27%  183 aa  APT_SODGM RecName: Full=Adenine phosphoribosyltransferase;       
   55::155     6e-06  35%  171 aa  APT_RHORT RecName: Full=Adenine phosphoribosyltransferase;       
   23::182     6e-06  27%  183 aa  APT_PHOLL RecName: Full=Adenine phosphoribosyltransferase;       
   54::168     6e-06  30%  180 aa  APT_MANSM RecName: Full=Adenine phosphoribosyltransferase;       
   32::165     6e-06  27%  173 aa  APT_CHLAA RecName: Full=Adenine phosphoribosyltransferase;       
   56::159     6e-06  36%  170 aa  APT_BACLD RecName: Full=Adenine phosphoribosyltransferase;       
   33::159     6e-06  31%  170 aa  APT_BACCN RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     8e-06  27%  183 aa  APT_SALG2 RecName: Full=Adenine phosphoribosyltransferase;       
   54::166     8e-06  30%  185 aa  APT_PECCP RecName: Full=Adenine phosphoribosyltransferase;       
   41::163     8e-06  27%  177 aa  APT_LEPBL RecName: Full=Adenine phosphoribosyltransferase;       
   41::163     8e-06  27%  177 aa  APT_LEPBJ RecName: Full=Adenine phosphoribosyltransferase;       
   24::171     8e-06  30%  172 aa  APT_LACS1 RecName: Full=Adenine phosphoribosyltransferase;       
   49::153     8e-06  30%  180 aa  APT_HAEIE RecName: Full=Adenine phosphoribosyltransferase;       
   49::155     8e-06  36%  170 aa  APT_BACP2 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALTY RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALTI RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALSV RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALPK RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALPC RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALPB RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALPA RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALNS RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALEP RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALDC RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALCH RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALA4 RecName: Full=Adenine phosphoribosyltransferase;       
   48::177     1e-05  31%  177 aa  APT_RHOOB RecName: Full=Adenine phosphoribosyltransferase;       
   48::151     1e-05  31%  172 aa  APT_PEDPA RecName: Full=Adenine phosphoribosyltransferase;       
   45::166     1e-05  30%  172 aa  APT_STRU0 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     1e-05  27%  183 aa  APT_SALHS RecName: Full=Adenine phosphoribosyltransferase;       
   44::173     1e-05  29%  175 aa  APT_MARMM RecName: Full=Adenine phosphoribosyltransferase;       
   29::166     1e-05  28%  170 aa  APT_LACLA RecName: Full=Adenine phosphoribosyltransferase;       
   36::168     1e-05  27%  177 aa  APT_IDILO RecName: Full=Adenine phosphoribosyltransferase;       
   22::170     1e-05  28%  187 aa  APT1_YEAST RecName: Full=Adenine phosphoribosyltransferase 1;      
   43::164     2e-05  31%  190 aa  PYRE_PELTS RecName: Full=Orotate phosphoribosyltransferase;        
   17::142     2e-05  27%  190 aa  APT_TREPS RecName: Full=Adenine phosphoribosyltransferase;       
   17::142     2e-05  27%  190 aa  APT_TREPA RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     2e-05  27%  170 aa  APT_STRSY RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     2e-05  27%  170 aa  APT_STRS2 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     2e-05  27%  170 aa  APT_STRGC RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAW RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAU RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAT RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAS RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAR RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAN RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAM RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAE RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAC RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAAB RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAA9 RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAA8 RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAA3 RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAA2 RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     2e-05  27%  172 aa  APT_STAA1 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     2e-05  27%  183 aa  APT_SALAR RecName: Full=Adenine phosphoribosyltransferase;       
   56::167     2e-05  32%  170 aa  APT_OCEIH RecName: Full=Adenine phosphoribosyltransferase;       
   31::133     2e-05  28%  187 aa  APT_METKA RecName: Full=Adenine phosphoribosyltransferase;       
   29::166     2e-05  28%  170 aa  APT_LACLM RecName: Full=Adenine phosphoribosyltransferase;       
   56::167     2e-05  33%  172 aa  APT_EXIS2 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     2e-05  27%  170 aa  APT_STRSV RecName: Full=Adenine phosphoribosyltransferase;       
   56::171     2e-05  32%  173 aa  APT_MACCJ RecName: Full=Adenine phosphoribosyltransferase;       
   56::149     2e-05  37%  170 aa  APT_GEOSW RecName: Full=Adenine phosphoribosyltransferase;       
   29::167     2e-05  27%  172 aa  APT_CLOK5 RecName: Full=Adenine phosphoribosyltransferase;       
   29::167     2e-05  27%  172 aa  APT_CLOK1 RecName: Full=Adenine phosphoribosyltransferase;       
    3::167     2e-05  31%  172 aa  APT_CLOB8 RecName: Full=Adenine phosphoribosyltransferase;       
   56::166     3e-05  29%  193 aa  PYRE_CHLPD RecName: Full=Orotate phosphoribosyltransferase;        
   39::166     3e-05  27%  172 aa  APT_STRPZ RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRPM RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRPG RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRPF RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRPD RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRPC RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRPB RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRP8 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRP6 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRP3 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     3e-05  27%  172 aa  APT_STRP1 RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     3e-05  29%  172 aa  APT_STRA1 RecName: Full=Adenine phosphoribosyltransferase;       
   56::161     3e-05  28%  172 aa  APT_STAS1 RecName: Full=Adenine phosphoribosyltransferase;       
   47::157     3e-05  29%  184 aa  APT_SHESH RecName: Full=Adenine phosphoribosyltransferase;       
   46::176     3e-05  29%  185 aa  APT_RUBXD RecName: Full=Adenine phosphoribosyltransferase;       
   31::175     3e-05  28%  177 aa  APT_LEUCK RecName: Full=Adenine phosphoribosyltransferase;       
   29::166     3e-05  28%  170 aa  APT_LACLS RecName: Full=Adenine phosphoribosyltransferase;       
   49::153     3e-05  29%  180 aa  APT_HAEIN RecName: Full=Adenine phosphoribosyltransferase;       
   49::153     3e-05  29%  180 aa  APT_HAEIG RecName: Full=Adenine phosphoribosyltransferase;       
   49::153     3e-05  29%  180 aa  APT_HAEI8 RecName: Full=Adenine phosphoribosyltransferase;       
   52::177     3e-05  27%  183 aa  APT_ENTS8 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     3e-05  26%  183 aa  APT_ENT38 RecName: Full=Adenine phosphoribosyltransferase;       
   56::167     3e-05  29%  170 aa  APT_ALKMQ RecName: Full=Adenine phosphoribosyltransferase;       
   74::160     4e-05  29%  219 aa  PYRE_YARLI RecName: Full=Orotate phosphoribosyltransferase;        
   50::177     4e-05  34%  181 aa  APT_VIBVY RecName: Full=Adenine phosphoribosyltransferase;       
   50::177     4e-05  34%  181 aa  APT_VIBVU RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     4e-05  27%  170 aa  APT_STRZT RecName: Full=Adenine phosphoribosyltransferase;       
   53::175     4e-05  30%  179 aa  APT_HAES2 RecName: Full=Adenine phosphoribosyltransferase;       
   53::175     4e-05  30%  179 aa  APT_HAES1 RecName: Full=Adenine phosphoribosyltransferase;       
   56::149     4e-05  36%  170 aa  APT_GEOTN RecName: Full=Adenine phosphoribosyltransferase;       
   56::149     4e-05  36%  170 aa  APT_GEOKA RecName: Full=Adenine phosphoribosyltransferase;       
   50::177     5e-05  34%  181 aa  APT_VIBHB RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     5e-05  25%  170 aa  APT_STRZP RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     5e-05  25%  170 aa  APT_STRR6 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     5e-05  25%  170 aa  APT_STRPN RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     5e-05  25%  170 aa  APT_STRPJ RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     5e-05  25%  170 aa  APT_STRPI RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     5e-05  25%  170 aa  APT_STRP7 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     5e-05  25%  170 aa  APT_STRP2 RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     5e-05  30%  172 aa  APT_STRMU RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     5e-05  29%  172 aa  APT_STRA5 RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     5e-05  29%  172 aa  APT_STRA3 RecName: Full=Adenine phosphoribosyltransferase;       
   46::161     5e-05  26%  172 aa  APT_STAHJ RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     5e-05  31%  183 aa  APT_SHIFL RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     5e-05  31%  183 aa  APT_SHIF8 RecName: Full=Adenine phosphoribosyltransferase;       
   38::149     5e-05  27%  170 aa  APT_FUSNN RecName: Full=Adenine phosphoribosyltransferase;       
  149::197     5e-05  41%  207 aa  APT_CORJK RecName: Full=Adenine phosphoribosyltransferase;       
   23::171     5e-05  27%  187 aa  APT_ASHGO RecName: Full=Adenine phosphoribosyltransferase;       
   61::165     6e-05  30%  193 aa  PYRE_PROA2 RecName: Full=Orotate phosphoribosyltransferase;        
   50::170     6e-05  36%  181 aa  APT_VIBPA RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     6e-05  31%  172 aa  APT_STRS7 RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     6e-05  31%  172 aa  APT_STREM RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     6e-05  31%  172 aa  APT_STRE4 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_SHISS RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_SHIDS RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_SHIBS RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_SHIB3 RecName: Full=Adenine phosphoribosyltransferase;       
   39::181     6e-05  30%  185 aa  APT_SHEDO RecName: Full=Adenine phosphoribosyltransferase;       
   29::167     6e-05  30%  170 aa  APT_KOSOT RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ESCF3 RecName: Full=Adenine phosphoribosyltransferase;       
    8::157     6e-05  29%  183 aa  APT_EDWI9 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOUT RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOSM RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOSE RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOLU RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOLI RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOLC RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOL6 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOL5 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOK1 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOHS RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECODH RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECOBW RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECO8A RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECO81 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECO7I RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECO55 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECO45 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECO27 RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     6e-05  27%  183 aa  APT_ECO24 RecName: Full=Adenine phosphoribosyltransferase;       
   52::177     6e-05  27%  183 aa  APT_CITK8 RecName: Full=Adenine phosphoribosyltransferase;       
   37::175     6e-05  28%  181 aa  APT_AERHH RecName: Full=Adenine phosphoribosyltransferase;       
   13::144     8e-05  26%  183 aa  PYRE_THETH RecName: Full=Orotate phosphoribosyltransferase;        
   13::144     8e-05  26%  183 aa  PYRE_THET8 RecName: Full=Orotate phosphoribosyltransferase;        
   13::144     8e-05  26%  183 aa  PYRE_THET2 RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     8e-05  31%  213 aa  PYRE_SERP5 RecName: Full=Orotate phosphoribosyltransferase;        
   56::181     8e-05  29%  187 aa  APT_YERE8 RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     8e-05  28%  172 aa  APT_STRTD RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     8e-05  28%  172 aa  APT_STRT2 RecName: Full=Adenine phosphoribosyltransferase;       
   39::149     8e-05  28%  172 aa  APT_STRT1 RecName: Full=Adenine phosphoribosyltransferase;       
   55::152     8e-05  28%  172 aa  APT_PROM0 RecName: Full=Adenine phosphoribosyltransferase;       
   48::163     8e-05  27%  175 aa  APT_LACC3 RecName: Full=Adenine phosphoribosyltransferase;       
   49::149     8e-05  30%  170 aa  APT_ENTFA RecName: Full=Adenine phosphoribosyltransferase;       
   62::159     8e-05  34%  172 aa  APT_CLOBB RecName: Full=Adenine phosphoribosyltransferase;       
   62::159     8e-05  34%  172 aa  APT_CLOBA RecName: Full=Adenine phosphoribosyltransferase;       
  264::388     1e-04  25%  505 aa  PUR1_SHIFL RecName: Full=Amidophosphoribosyltransferase;       
  264::388     1e-04  25%  505 aa  PUR1_ECOLI RecName: Full=Amidophosphoribosyltransferase;       
   34::156     1e-04  28%  173 aa  APT_SOLUE RecName: Full=Adenine phosphoribosyltransferase;       
   37::167     1e-04  24%  178 aa  APT_PELCD RecName: Full=Adenine phosphoribosyltransferase;       
   35::166     1e-04  28%  181 aa  APT1_WHEAT RecName: Full=Adenine phosphoribosyltransferase 1;      
   99::186     1e-04  30%  215 aa  PYRE_YERPY RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERPS RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERPP RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERPN RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERPG RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERPE RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERPB RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERPA RecName: Full=Orotate phosphoribosyltransferase;        
   99::186     1e-04  30%  215 aa  PYRE_YERP3 RecName: Full=Orotate phosphoribosyltransferase;        
   35::177     1e-04  26%  181 aa  APT_VIBCM RecName: Full=Adenine phosphoribosyltransferase;       
   35::177     1e-04  26%  181 aa  APT_VIBCH RecName: Full=Adenine phosphoribosyltransferase;       
   35::177     1e-04  26%  181 aa  APT_VIBC3 RecName: Full=Adenine phosphoribosyltransferase;       
   39::166     1e-04  25%  170 aa  APT_STRP4 RecName: Full=Adenine phosphoribosyltransferase;       
    8::181     1e-04  25%  183 aa  APT_SHESR RecName: Full=Adenine phosphoribosyltransferase;       
   50::179     1e-04  26%  181 aa  APT_SHEAM RecName: Full=Adenine phosphoribosyltransferase;       
   58::177     1e-04  29%  177 aa  APT_RHOSR RecName: Full=Adenine phosphoribosyltransferase;       
   51::179     1e-04  31%  182 aa  APT_RENSM RecName: Full=Adenine phosphoribosyltransferase;       
   52::175     1e-04  27%  175 aa  APT_COPPD RecName: Full=Adenine phosphoribosyltransferase;       
   28::149     1e-04  25%  170 aa  APT_ACHLI RecName: Full=Adenine phosphoribosyltransferase;       
   42::142     2e-04  26%  187 aa  PYRE_THEMA RecName: Full=Orotate phosphoribosyltransferase;        
   74::186     2e-04  28%  214 aa  PYRE_ACTSZ RecName: Full=Orotate phosphoribosyltransferase;        
   45::181     2e-04  25%  187 aa  APT_YERPY RecName: Full=Adenine phosphoribosyltransferase;       
   45::181     2e-04  25%  187 aa  APT_YERPS RecName: Full=Adenine phosphoribosyltransferase;       
   45::181     2e-04  25%  187 aa  APT_YERPB RecName: Full=Adenine phosphoribosyltransferase;       
   45::181     2e-04  25%  187 aa  APT_YERP3 RecName: Full=Adenine phosphoribosyltransferase;       
   35::177     2e-04  29%  181 aa  APT_VIBF1 RecName: Full=Adenine phosphoribosyltransferase;       
   67::164     2e-04  32%  198 aa  APT_SERP5 RecName: Full=Adenine phosphoribosyltransferase;       
   43::146     2e-04  30%  182 aa  APT_PSEU2 RecName: Full=Adenine phosphoribosyltransferase;       
   53::150     2e-04  27%  171 aa  APT_PROMP RecName: Full=Adenine phosphoribosyltransferase;       
   29::149     2e-04  27%  170 aa  APT_NITMS RecName: Full=Adenine phosphoribosyltransferase;       
   28::178     2e-04  26%  188 aa  APT_CANAL RecName: Full=Adenine phosphoribosyltransferase;       
   50::175     2e-04  29%  181 aa  APT_AERS4 RecName: Full=Adenine phosphoribosyltransferase;       
   74::186     2e-04  27%  213 aa  PYRE_YERE8 RecName: Full=Orotate phosphoribosyltransferase;        
   85::186     2e-04  28%  232 aa  PYRE_RHIME RecName: Full=Orotate phosphoribosyltransferase;        
   56::181     2e-04  26%  187 aa  APT_YERPP RecName: Full=Adenine phosphoribosyltransferase;       
   56::181     2e-04  26%  187 aa  APT_YERPN RecName: Full=Adenine phosphoribosyltransferase;       
   56::181     2e-04  26%  187 aa  APT_YERPG RecName: Full=Adenine phosphoribosyltransferase;       
   56::181     2e-04  26%  187 aa  APT_YERPE RecName: Full=Adenine phosphoribosyltransferase;       
   56::181     2e-04  26%  187 aa  APT_YERPA RecName: Full=Adenine phosphoribosyltransferase;       
   32::170     2e-04  24%  173 aa  APT_UREPA RecName: Full=Adenine phosphoribosyltransferase;       
   32::170     2e-04  24%  173 aa  APT_UREP2 RecName: Full=Adenine phosphoribosyltransferase;       
  110::170     2e-04  44%  172 aa  APT_SYNPW RecName: Full=Adenine phosphoribosyltransferase;       
    8::181     2e-04  25%  183 aa  APT_SHESM RecName: Full=Adenine phosphoribosyltransferase;       
    8::181     2e-04  25%  183 aa  APT_SHESA RecName: Full=Adenine phosphoribosyltransferase;       
   52::179     2e-04  25%  183 aa  APT_SHEPW RecName: Full=Adenine phosphoribosyltransferase;       
   56::149     2e-04  31%  172 aa  APT_EXISA RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     2e-04  26%  183 aa  APT_ECO5E RecName: Full=Adenine phosphoribosyltransferase;       
   52::169     2e-04  26%  183 aa  APT_ECO57 RecName: Full=Adenine phosphoribosyltransferase;       
   50::149     2e-04  32%  170 aa  APT_CARHZ RecName: Full=Adenine phosphoribosyltransferase;       
   39::156     2e-04  27%  177 aa  APT_ACIC1 RecName: Full=Adenine phosphoribosyltransferase;       
  117::156     3e-04  32%  207 aa  PYRE_VESOH RecName: Full=Orotate phosphoribosyltransferase;        
   59::182     3e-04  26%  184 aa  APT_SHESW RecName: Full=Adenine phosphoribosyltransferase;       
   59::182     3e-04  26%  184 aa  APT_SHEPC RecName: Full=Adenine phosphoribosyltransferase;       
   59::182     3e-04  27%  184 aa  APT_SHEB9 RecName: Full=Adenine phosphoribosyltransferase;       
   59::182     3e-04  27%  184 aa  APT_SHEB8 RecName: Full=Adenine phosphoribosyltransferase;       
   59::182     3e-04  27%  184 aa  APT_SHEB5 RecName: Full=Adenine phosphoribosyltransferase;       
   59::182     3e-04  27%  184 aa  APT_SHEB2 RecName: Full=Adenine phosphoribosyltransferase;       
   67::151     3e-04  33%  182 aa  APT_SACEN RecName: Full=Adenine phosphoribosyltransferase;       
   34::152     3e-04  25%  172 aa  APT_PROMA RecName: Full=Adenine phosphoribosyltransferase;       
   67::147     3e-04  31%  169 aa  APT_MYCS5 RecName: Full=Adenine phosphoribosyltransferase;       
  113::168     3e-04  41%  171 aa  APT_CLOCE RecName: Full=Adenine phosphoribosyltransferase;       
   58::178     3e-04  27%  184 aa  APT_BLOPB RecName: Full=Adenine phosphoribosyltransferase;       
   45::164     3e-04  23%  181 aa  APT_ACIC5 RecName: Full=Adenine phosphoribosyltransferase;       
  121::191     4e-04  37%  211 aa  UPP_COREF RecName: Full=Uracil phosphoribosyltransferase;       
   55::156     4e-04  35%  219 aa  PYRE_XANCP RecName: Full=Orotate phosphoribosyltransferase;        
   55::156     4e-04  35%  219 aa  PYRE_XANCB RecName: Full=Orotate phosphoribosyltransferase;        
   55::156     4e-04  35%  219 aa  PYRE_XANC8 RecName: Full=Orotate phosphoribosyltransferase;        
   85::186     4e-04  29%  232 aa  PYRE_SINMW RecName: Full=Orotate phosphoribosyltransferase;        
   83::161     4e-04  30%  210 aa  PYRE_BACHD RecName: Full=Orotate phosphoribosyltransferase;        
  114::149     4e-04  44%  170 aa  APT_SYMTH RecName: Full=Adenine phosphoribosyltransferase;       
   43::154     4e-04  28%  182 aa  APT_PSESM RecName: Full=Adenine phosphoribosyltransferase;       
   43::146     4e-04  29%  182 aa  APT_PSE14 RecName: Full=Adenine phosphoribosyltransferase;       
   49::167     4e-04  28%  177 aa  APT_PROAC RecName: Full=Adenine phosphoribosyltransferase;       
   29::149     4e-04  25%  170 aa  APT_MESFL RecName: Full=Adenine phosphoribosyltransferase;       
   73::169     4e-04  31%  193 aa  APT_BIFLO RecName: Full=Adenine phosphoribosyltransferase;       
   52::146     5e-04  29%  190 aa  PYRE_THETN RecName: Full=Orotate phosphoribosyltransferase;        
   74::186     5e-04  25%  217 aa  PYRE_AERS4 RecName: Full=Orotate phosphoribosyltransferase;        
   59::152     5e-04  30%  173 aa  APT_LISW6 RecName: Full=Adenine phosphoribosyltransferase;       
   59::152     5e-04  30%  173 aa  APT_LISMO RecName: Full=Adenine phosphoribosyltransferase;       
   59::152     5e-04  30%  173 aa  APT_LISMH RecName: Full=Adenine phosphoribosyltransferase;       
   59::152     5e-04  30%  173 aa  APT_LISMF RecName: Full=Adenine phosphoribosyltransferase;       
   59::152     5e-04  30%  173 aa  APT_LISMC RecName: Full=Adenine phosphoribosyltransferase;       
   59::152     5e-04  30%  173 aa  APT_LISIN RecName: Full=Adenine phosphoribosyltransferase;       
   51::151     5e-04  29%  172 aa  APT_LACSS RecName: Full=Adenine phosphoribosyltransferase;       
   30::160     5e-04  22%  171 aa  APT_GEOUR RecName: Full=Adenine phosphoribosyltransferase;       
   30::135     5e-04  27%  171 aa  APT_GEOLS RecName: Full=Adenine phosphoribosyltransferase;       
  114::167     5e-04  37%  181 aa  APT_COLP3 RecName: Full=Adenine phosphoribosyltransferase;       
   56::177     5e-04  32%  181 aa  APT_ALISL RecName: Full=Adenine phosphoribosyltransferase;       
   42::142     7e-04  25%  187 aa  PYRE_THESQ RecName: Full=Orotate phosphoribosyltransferase;        
   42::142     7e-04  25%  187 aa  PYRE_THEP1 RecName: Full=Orotate phosphoribosyltransferase;        
   42::142     7e-04  25%  187 aa  PYRE_THENN RecName: Full=Orotate phosphoribosyltransferase;        
   37::179     7e-04  23%  181 aa  APT_PSEHT RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     7e-04  38%  172 aa  APT_PROMM RecName: Full=Adenine phosphoribosyltransferase;       
  108::149     7e-04  38%  172 aa  APT_PROM3 RecName: Full=Adenine phosphoribosyltransferase;       
   50::139     7e-04  28%  171 aa  APT_GEOSF RecName: Full=Adenine phosphoribosyltransferase;       
   62::149     7e-04  33%  172 aa  APT_CLONN RecName: Full=Adenine phosphoribosyltransferase;       
  105::151     7e-04  36%  172 aa  APT_ANAVT RecName: Full=Adenine phosphoribosyltransferase;       
  105::151     7e-04  36%  172 aa  APT_ANASP RecName: Full=Adenine phosphoribosyltransferase;       
  115::176     7e-04  36%  177 aa  APT_ANADF RecName: Full=Adenine phosphoribosyltransferase;       
   85::186     0.001  28%  232 aa  PYRE_RHISN RecName: Full=Orotate phosphoribosyltransferase;        
   58::151     0.001  29%  175 aa  APT_LACJO RecName: Full=Adenine phosphoribosyltransferase;       
   33::173     0.001  23%  179 aa  APT_BRASO RecName: Full=Adenine phosphoribosyltransferase;       
    1::191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVAR
XPT_CLOPH       MQLLKDRIRKDGIVKQGNVLKVDSFLNHQMDIELINEIGKEFKRLFEKEKITKILTIEASGIGIACIVAQ
XPT_BIFLO       MQELEERIQSEGTVKAGNVLKVDAFLNHQCDVRLFDRMGSAWAAHFAGKHITKILTIEASGIGIACVAAQ
XPT_BIFLD       MQELEERIQSEGTVKAGNVLKVDAFLNHQCDVRLFDRMGSAWAAHFAGKHITKILTIEASGIGIACVAAQ
XPT_BIFAA       MKELEERIVQQGTVKPGNVLKVDAFLNHQCDVELFDHMGAAWAEHFKGKTIDKILTIEASGIGIACVVAR
XPT_BIFLI       MQELEERIQSEGTVKEGDVLKVDAFLNHQCDVRLFDRMGSAWAAHFAGKHITKILTIEASGIGIACVAAQ
XPT_BIFA0       MQELEERIREQGVVKPGNVLKVDAFLNHQCDVRLFDHMGAAWAEHFNNKHITKILTIEASGIGIACVAAT
XPT_CLOCE       MELLKQRILKDGRVIGNDILKVDSFLNHQMDVALFNEMGKEFHKQFAHKNITKILTIEASGIGIACIAAQ
XPT_CLONN       MELLKKRILEDGNVFGEDVLKVDSFLNHQIDVKLLNEIGKEFKRRFENKEITKILTIEASGIGIACIAAQ
XPT2_CLOBL      MKLLEDKILKEGILLEGNILKVDSFLNHQMDVKLFNEIGKEFKRRFEGCNINKILTIEASGIGIATIVSQ
XPT2_CLOBH      MKLLEDKILKEGILLEGNILKVDSFLNHQMDVKLFNEIGKEFKRRFEGCSINKILTIEASGIGIATIVSQ
XPT2_CLOB1      MKLLEDKILKEGILLEGNILKVDSFLNHQMDVKLFNEIGKEFKRRFEGCSINKILTIEASGIGIATIVSQ
XPT_LACSS       MRLLEERIKKDGQVLGEDVLKVDNFLNHQVDPELMAAMGEEFKRLFEGAPITKILTVESSGIAPAVFSGL
XPT_ALKMQ       MELLKEQIREVARVEKGNVLKVDSFLNHQLDIPLLNEIGKELKKRFQGEKVDKILTAEVSGIAIAAIAAQ
XPT_CLOD6       MKALQEKILREGSVSGNDILKVDSFLNHQIDVAFLNEIGREFKERFKGEKVDKIFTIEASGIAIASIVSQ
XPT_PSE14       MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPALMKEIGDEFARLFADAGVTKIVTIEASGIAPAVMAGL
XPT_FINM2       MRKLEERIMKDGLVLPGNILKVDRFINHMIDPVLFEDLANEFYEKFKDKKINKILTIEVSGIAIAYACGI
XPT_LACCB       MKLLEDRIKKDGQVIGTDVLKVDNFLNHQVDPDLMADLGHEFYRRFSNEPITKILTVESSGIAPAIATAM
XPT_LACC3       MKLLEDRIKKDGQVIGTDVLKVDNFLNHQVDPDLMADLGHEFYRRFSNEPITKILTVESSGIAPAIATAM
XPT_BACSK       MELLKEAIRKRGSVLSSGVLKVDQFLNHQVDTNLMSAIGEEFARLFADEHVTKVVTIESSGIAPSFMCAH
XPT_PSEU2       MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPALMKEIGDEFARLFADAGVTKIVTIEASGIAPAVMAGL
XPT_PSEPK       MEALHQKIREEGIVLSDQVLKVDAFLNHQIDPALMQLIGDEFARLFADAGVTKIVTIEASGIAPAVMTGL
XPT_PSEPG       MEALHQKIREEGIVLSDQVLKVDAFLNHQIDPALMQLIGDEFARLFADAGVTKIVTIEASGIAPAVMTGL
XPT_PSEP1       MEALHQKIREEGIVLSDQVLKVDAFLNHQIDPALMQLIGDEFARLFADAGVTKIVTIEASGIAPAVMTGL
XPT_MOOTA       VELLKEKIRQEGRVISDDVLKVDSFLNHQIDPVLMLKVGEEFARRFAGSAITKVLTVEASGIAVALMTGL
XPT_PSESM       MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPALMKAIGDEFARLFADAGVTKIVTIEASGIAPAVMAGL
XPT_PSEE4       MEALQQKIREEGIVLSDQVLKVDAFLNHQIDPALMQLIGDEFARLFADSGVTKIVTIEASGIAPAVMTGL
XPT_CLOTE       MNILKDKINKEGIVIDNRILRVDMFLNHQLDIELLNEIGKEFKNRFKDKEINKILTVETSGIGIACVVAQ
XPT_OCEIH       MELLKNKIIEEGRVLSDTVLKVDSFLNHQVDPKLMKQVGEEFAKKFRNTGITKILTIESSGIAPATMTGL
XPT_LARHH       METLKRKIIDEGRLLDGHILKVDNFLNHQIDVRLMNDIGQAFAERFAGTRIDKILTIEASGIAVAAIASQ
XPT_ENTFA       MKELVERIKNDGRVLGEGVLKVDSFITHQVDPELMEAMGNRFAEVFAEAGITKVITIEASGIAPALYAAQ
XPT_PSEAE       MDILKDKIRSEGIVLSEHVLKVDAFLNHQIDPQLMQQVGHAFATRFRDQGITKIVTIEASGIAPAVMAGL
XPT_PSEAB       MDILKDKIRSEGIVLSEHVLKVDAFLNHQIDPQLMQQVGHAFAMRFRDQGITKIVTIEASGIAPAVMAGL
XPT_PSEA8       MDILKDKIRSEGIVLSEHVLKVDAFLNHQIDPQLMQQVGHAFAMRFRDQGITKIVTIEASGIAPAVMAGL
XPT_LACS1       MKLLEERIKKDGVVLPGNVLKVNQFLNHQIDPELMYKMGEEFARLFKDEEITKIITVESSGIAPAVMTGL
XPT_PSEA7       MDTLKDKIRSEGIVLSEHVLKVDAFLNHQIDPQLMQQVGHAFATRFRDQGITKIVTIEASGIAPAVMAGL
XPT_PSEU5       MEQLKDKIRSHGIVLSDRVLKVDAFLNHQIDPVLMQAIGREFARRFRDDGITKIVTIEASGIAPAVMAGL
XPT_BACV8       MKALKERILRDGKCFEGGILKVDNFINHQMDPILMKSIAVEFVRRFASTNINKVMTIEASGIAPAIMVGY
XPT_ACIAD       MYALEQKILNEGIVLSDQVLKVDAFLNHQIDPVLMQQIGKEFAARFKDTGITKIVTIEASGIAPAVMAGL
XPT_ACIBT       MHALEQKILTEGIVLSDQVLKVDAFLNHQIDPVLMQQIGKEFAARFKDAGITKIITIEASGIAPAIMAGL
XPT_ACIBC       MHALEQKILTEGIVLSDQVLKVDAFLNHQIDPVLMQQIGKEFAARFKDAGITKIITIEASGIAPAIMAGL
XPT_ACIB5       MHALEQKILTEGIVLSDQVLKVDAFLNHQIDPVLMQQIGKEFAARFKDAGITKIITIEASGIAPAIMAGL
XPT_ACIB3       MHALEQKILTEGIVLSDQVLKVDAFLNHQIDPVLMQQIGKEFAARFKDAGITKIITIEASGIAPAIMAGL
XPT_BACCN       MKVLQEKILSEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFQEEKITKIVTIESSGIAPAVMAAL
XPT_LACBA       MKILEDRIRQDGTVLTGNVLKVDNFLNHQVDPQLMNELGQEFARRFQDAHITKILTVESSGIAPAVMAGL
XPT_STRPS       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAAAGITKVVTIEASGIAPAVFTAE
XPT_PSEPF       MEALHQKIREQGIVLSDQVLKVDAFLNHQIDPALMKLIGDEFATLFKDSGITKIVTIEASGIAPAIMTGL
XPT_PSEF5       MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPQLMKLIGDEFATLFKDSGITKIVTIEASGIAPAIMTGL
XPT_STRZT       MKLLEDRILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAAAGITKVVTIEASGIAPAVFTAE
XPT_STRSV       MKKLEERILRDGQVLGENILKVDSFLTHQVDFSLMKEIGQVFAEAVKDAGITKVVTIEASGIAPAVYVAE
XPT_PSEFS       MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPALMKLIGDEFAALFKDSGITKIVTIEASGIAPAIMTGL
XPT_STRZJ       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_STRR6       MKLLEERILKDGHILDDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_STRPJ       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_STRPI       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_STRP7       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_STRP4       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_STRP2       MKLLEERILKDGHILDDNILKVDSFLTHQVDFSLMREIGKVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_STRA5       MKLLEERILKDGDVLGENILKVDSFLTHQVDFELMQEIGKVFADKYKEAGITKVVTIEASGIAPAVYAAQ
XPT_STRA3       MKLLEERILKDGDVLGENILKVDSFLTHQVDFELMQEIGKVFADKYKEAGITKVVTIEASGIAPAVYAAQ
XPT_STRA1       MKLLEERILKDGDVLGENILKVDSFLTHQVDFELMQEIGKVFADKYKEAGITKVVTIEASGIAPAVYAAQ
XPT_STRZP       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGRVFAEKFAATGITKVVTIEASGIAPAVFTAE
XPT_BACHD       MESLKQAIRERGNVLSDTVLKVDSFLNHQVDPKLINEIGQAFAERFKNEGITKVLTIESSGIAPSLVVAT
XPT_STRPN       MKLLEERILKDGHILGDNILKVDSFLTHQVDFSLMREIGKVFAEKFATTGITKVVTIEASGIAPAVFTAE
XPT_STRGC       MKKLEERILRDGNVLGENILKVDSFLTHQVDFTLMKEIGQVFADIFHESGITKVVTIEASGIAPAVYTAE
XPT_STRU0       MKLLEERIIKDGNVLGENILKVDSFLTHQVDYHLMRDIGKVFAESYADAGITKVVTIEASGIAPAVYVAE
XPT_LACPL       MRELEERILKDGRVLPGEVLKVDGFLNHQVDPDLMFAMGTEFAHLFQDAGVTKILTVESSGIAPAVMAGL
XPT_BREBN       MKELQERIVQDGKVLSASVLKVDAFLNHQVDPQLTMKIGQRFAELFAGENITKVVTIEASGIHFAMATSF
XPT1_CLOBL      MEKLQNRILQEGHALSETVLKVDSFLNHQVDPDLMYEIGTYFKNYFKEHKITKIFTIESSGIAPAVMTAM
XPT_PSEMY       MESLKQKILSEGIVLSDQVLKVDAFLNHQIDPALMQQIGHEFAQRFAGQGITKIVTIEASGIAPAVMAGL
XPT_BACLD       MEKLKRKIAEQGTVLSDEVLKVDSFLNHQIDPELMLAVGEEFASLFREEGVTKIVTIESSGIAPAVMAGL
XPT_STAAR       MELLGQKVKEDGVVIDERILKVDGFLNHQIDAKLMDEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT1_CLOPS      MEALKEKILKEGKVREGNILKVDCFLNHQMDIKFLNEVGKEFRKRFEGEKVDKILTXXXXXXXXXXXXXQ
XPT1_CLOPE      MEALKEKILKEGKVREGNILKVDCFLNHQMDIKFLNEVGKEFRKRFEGEKVDKILTXXXXXXXXXXXXXQ
XPT1_CLOP1      MEALKEKILKEGKVREGNILKVDCFLNHQMDIKFLNEVGKEFRKRFEGEKVDKILTXXXXXXXXXXXXXQ
XPT_BACA2       MEALKRKIAEDGIVLSDQVLKVDSFLNHQIDPVLMQQIGREFARRFEKDEITKIVTIESSGIAPAVMAGL
XPT_EXIS2       MKRLEEMIKQEGLVLSDQVLKVDSFLNHQVDPTLMWEIAYEFMDRFKDAGITRILTIEAGGIAPAMMTAL
XPT_STAS1       MDLLKQKVEADGVVIDEKILKVDGFLNHQIDARLMHDVGQTFYEQFKDEGITKILTIEASGIAPAIMAAM
XPT_STAES       MESLGRKVKEDGVVIDEKILKVDGFLNHQIDAKLMNDVGKTFYESFKDAGITKILTIEASGIAPAIMASF
XPT_STAEQ       MESLGRKVKEDGVVIDEKILKVDGFLNHQIDAKLMNDVGKTFYESFKDAGITKILTIEASGIAPAIMASF
XPT_STACT       MEALRQKVKEDGVVIGEKILKVDGFLNHQIDAQLMYDIGETFYEQFKDQKVTKILTVEASGIAPAIMVAY
XPT_STAAW       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAAT       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAAS       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAAN       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAAM       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAAE       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAAC       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAAB       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAA9       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAA8       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAA3       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAA2       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_STAA1       MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAAL
XPT_LISMO       MKLLEEFIQEKGTVLPGNVLKVDAFLNHQIDPVLMQAMGNEFAKRFQDLGITKIVTIESSGIAPAVFAGL
XPT_LISMF       MKLLEEFIQEKGTVLPGNVLKVDAFLNHQIDPVLMQAMGNEFAKRFQDLGITKIVTIESSGIAPAVFAGL
XPT1_CLOBH      MEKLQNRILQEGHALSETVLKVDSFLNHQVDPDLMYEIGTYFKNYFKEHKITKVFTIESSGIAPAVMTAM
XPT1_CLOB1      MEKLQNRILQEGHALSETVLKVDSFLNHQVDPDLMYEIGTYFKNYFKEHKITKVFTIESSGIAPAVMTAM
XPT_CLOB8       MESLHKRILEEGQALSENVLKVDSFLNHQVDPELMYEMGTYFKNYFENHKITKVFTIESSGIAPAVMTAM
XPT_LISMC       MKLLEEFIQEKGTVLPGNVLKVDAFLNHQIDPVLMQAMGNEFAKRFQDLGITKIVTIESSGIAPAVFAGL
XPT_MACCJ       MEKLQQRVKEDGVVIDGGILKVDSFLNHQIDPELMYEVGETIYNKYKDEGITKVLTIEASGIAPAIMTAL
XPT_PEDPA       MKLLEDKIKSEGIVLPNNVLKVDGFLNHQVDAQLMFEIGKEFGRLFKKQNVTKILTVESSGIAPAVMTGL
XPT_LACLM       MKLLEDRINTDGQVLGQDILKVDRFLTHQVDYQLMKEIGKRFAQVYADAGVTKVVTIEASGIAPALYAAE
XPT_STAHJ       MESLRQKVKEDGVVIDEKILKVDGFLNHQIDAKLMHEVGKTFYEQFKDKGVTKILTIEASGIAPAIMASL
XPT_LACLS       MKLLEDRIHSDGQVLGQDILKVDRFLTHQVDYQLMKEIGKRFAQVYADAEVTKVVTIEASGIAPALYAAE
XPT_EXISA       MKQLEDKIREEGRALSDQVLKVDAFLNHQVDPVLMQAIGKEFAERFKDAQIDRIVTLESSGIAPAMMTAL
XPT_BACFR       MQLLKKRILQDGKCYEGGILKVDSFINHQMDPVLMKSIGVEFVRLFAGTNVNKIMTIEASGIAPAIMTGY
XPT_BACFN       MQLLKKRILQDGKCYEGGILKVDSFINHQMDPVLMKSIGVEFVRLFAGTNVNKIMTIEASGIAPAIMTGY
XPT_LACLA       MKLLEDRIHTDGQVLGQDILKVDRFLTHQVDYQLMKEIGKRFAQVYANAGVTKVVTIEASGIAPALYAAE
XPT_BACSU       MEALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLMQRIGDEFASRFAKDGITKIVTIESSGIAPAVMTGL
XPT_GEOTN       MRELLEKIAAEGEVVADGVLKVDRFLNHQVDPHLMKRIGEEFAAQFHRERPTKVLTLESSGISPALMAAY
XPT_OENOB       IKILEEKIKSEGIVLGSDILKVNSFLNHQIDPFLMSQIGQAFAEKFSHENISKVLTIESSGIAPALMTSL
XPT_EUBR3       MKELQDRILKDGQVIGTNILKVNKFINHQVDPVLMEHIGEDFANHFADKGITKVVTIESSGIAPALMAAA
XPT_STRTR       MKLLEDRILNDGDVLGENILKL-TFLTHQVDFELMREIGKVFAEKFKDTGITKVVAIEASGIAPALYATE
XPT2_CLOPS      MELLKDKIKKEGRVTEDNILMVDSFLNHQMDVEFFNEVGKEFKDRFKNDQIDKILTIESTGIGLGIITAQ
XPT2_CLOPE      MELLKDKIKKEGRVTEDNILMVDSFLNHQMDVEFFNEVGKEFKDRFKNDQIDKILTIESTGIGLGIITAQ
XPT2_CLOP1      MELLKDKIKKEGRVTEDNILMVDSFLNHQMDVEFFNEVGKEFKDRFKNDQIDKILTIESTGIGLGIITAQ
XPT_PARD8       MELLKQRILQDGRCYPGGILKVDSFINHQMDPMLMYKIAEEFIRRFQDRKINKIVTIEASGIAPAIMVGY
XPT_BACTN       MQLLKKRILQDGKCYEGGILKVDGFINHQMDPVLMKSIGVEFVRRFAATNVNKIMTIEASGIAPAIMTGY
XPT_LEUMM       MKILEQRIKKDGRVLGKDVLKVDSFLNHQVDPELMQAMGEEFATIFSDEKIDKIVTVESSGIAPAVFAGL
XPT_BACC2       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_STRMT       ----------------DNILKVDSFLTHQVDFSLMREIGKVFAEKFASAGITKVVTIEASGIAPAVFTAE
XPT_LACRJ       MKELEEKIKEYGTVLPGNVLKVDAFLNHQVDPQLMLHIGQKFAKLFANEGITKIWTVESSGIAPAVMTGL
XPT_LACRD       MKELEEKIKEYGTVLPGNVLKVDAFLNHQVDPQLMLHIGQKFAKLFANEGITKIWTVESSGIAPAVMTGL
XPT_BACWK       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACCR       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACC1       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_STRE4       MRLLEERILADGTVLGETILKVDQFLTHQVDYRLMKEIGRVFADQYADLGITKVVTIEASGIAPAVYTAE
XPT_BACHK       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACCQ       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACC7       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACC0       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACAN       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACAC       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACAA       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACCZ       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACC4       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPSVMAAL
XPT_STRS7       MRLLEERILAEGTVLGETILKVDQFLTHQVDYRLMKEIGRVFADQYADLGITKVVTIEASGIAPAVYTAE
XPT_LACDB       MELLEERIKKDGVVLPGNVLKVNSFLNHQIDPQLMMTLGQEFARLFKDAGVTRVLTAEASGIAPGIMAAY
XPT_LACDA       MELLEERIKKDGVVLPGNVLKVNSFLNHQIDPQLMMTLGQEFARLFKDAGVTRVLTAEASGIAPGIMAAY
XPT_LACAC       MKLLEERIKRDGEVLDGNVLKINSFLNHQVDPKLMMEVGKEFKRLFAGEQIDKVLTCEASGIAPGVMTAY
XPT_BACC3       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_BACAH       MKVLQEKILNEGKVLSGDVLKVDAFLNHQIDPVLMQEIGKEFAKRFKEENITKIVTIESSGIAPAVMAAL
XPT_AZOVD       MEQLKRKIREHGSVLSEQVLKVDAFLNHQVDPQLMRQIGQEFARRFRDQEIDKVITLETSGIAPALMTAL
XPT_PORGI       MELLKQRILQDGKCYPGGILKVDSFINHQMDSKLMYHVAEEFARLFADSGVNKIVTIEASGIAPAIMVGY
XPT_PORG3       MELLKQRILQDGKCYPGGILKVDSFINHQMDSKLMYHVAEEFARLFADSGVNKIVTIEASGIAPAIMVGY
XPT_LACF3       MKELEEKIRQFGTVLPGNVLKVDAFLNHQVDPVLMQHIGQEFAARFKDAKITKVWTVESSGIAPAVMTGL
XPT_HELMI       MQELKDRILAEGEVIGTHILKVDTFLNHQIDPAFILRMGKELADRFAGAGITRVLTXXXXXXXXXXXXXX
XPT_LACH4       MKLLEDRIKKDGEVLDGDVLKINSFLNHQVDPQLMMQCGEEFKRLFADQKIDKVLTCEASGIAPGVMTAY
XPT_DEIRA       MQSLVEAIKREGRVLPGGFLKVDGLVNHQLHPALTREMGETFARHFAPLAPTKVLTIEVSGIAPAIMTAA
XPT_BACP2       MELLRQKIENEGIVLSNQVLKVDAFLNHQIDPVLMHEIGQEFAKLFKHDGITKIITIESSGIAPAVMAGL
XPT_LISW6       MKLLEEFIKEKGTVLPGNVLKVDAFLNHQIDPGLMQEMGKAFAERFQDLGITKIVTIESSGIAPAVFAGL
XPT_DESRM       ---LKEIIENNAEVVSDQILRVDSFINHMIDPNVMMEIGEEFARRFRDDKITKVLTIEASGIAIGXXXXX
XPT_STRPG       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_LISIN       MKLLEEFIQEKGTVLPGNVLKVDAFLNHQIDPGLMQEMGKAFAERFKDLGITKIVTIESSGIAPAVFAGL
XPT_STRPM       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRPF       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRPD       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRPC       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRPB       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRP8       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRP6       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRP3       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRP1       MQLLEERILTDGNILGENILKVDNFLTHQVDYRLMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_STRPZ       MQLLEERILTDGNILGENILKVDNFLTHQVDYRSMKAIGKVFAQKYAEAGITKVVTIEASGIAPAVYAAE
XPT_DEIGD       MQALVEAIRERGMILPGGMLKVDGLINHQLLPQLTREMGERFAAGFAPLNPNKVVTIEVSGIAPALATAL
XPT_DEIDV       MRALVDAIRAQGTVLPGGILKVDGLINHQLLPQLTREMGETFARSFGPLKPTKVVTIEVSGIAPALATSM
XPT_LACJO       MKLLEERIRKDGEVLDGNVLKINSFLNHQVDPQLMMEVGKEFKRLFENEKITKVLTCEASGIAPGIMAAY
XPT_LACGA       MKLLEERIRKDGEVLDGDVLKINSFLNHQVDPELMMQVGEEFKRLFENEKITKVLTCEASGIAPGIMAAY
XPT_CLOAB       MEQLCKRILEEGKALNEYVLKVDSFLNHNVDPKLMYEIGTYFKEYFSARGITKIFTIESSGIAPAVMTAL
XPT_CLOBB       MENLHKRILEEGQALSNDVLKVDSFLNHQVDADLMYEMGTYFKNYFKDHNITKIFTIESSGIAPTVMTAM
XPT_CLOBA       MENLHNRILEEGQALSSDVLKVDSFLNHQVDADLMYEMGTYFKNYFKDHNITKIFTIESSGIAPTVMTAM
XPT_CHLSY       ---LAQRIIQEGVVVNDRILKIDHFLNHRIDTDLMSAIGVELATRLQPFAAELILTAEASGIXXXXXXXX
XPT_CHLAA       ---LAQRIIQEGVVVNDRILKIDHFLNHRIDTDLMSAIGVELATRLQPFAAELILTAEASGIXXXXXXXX
PURR_BACSU      -----ERILPGGYVYLTDILGKPSVLSK---------VGKLFASVFAEREIDVVMTVATKGIPLAYAAAS
PURR_STRR6      -------------------------------------IGRIIAKSFMDQKIDAVMTVATKGVPLANAVAN
PURR_STRPN      -------------------------------------IGRIIAKSFMDQKIDAVMTVATKGVPLANAVAN
APT_DESMR       ---------------------------------------------FADSGATKIVAAEARGFIFGAALAY
APT_META3       -----------------------------------------------DLNVDKIITAEAMGIPLATAISL
APT1_METVS      -----------------------------------------------DTNVDKIVTAEAMGIPIVTAVSI
APT1_METM7      -----------------------------------------------DTDIDKIVTAEAMGIPIVTAVSI
APT2_METM5      -----------------------------------------------DTEVDKIVTAEAMGIPIVTAVSI
APT1_METMP      -----------------------------------------------DTDVDKIVTAEAMGIPIVTAVSI
PURR_LACLM      -------------------------------------IGQIIAHEYHEKQVDVVMTIATKGIPIAQSVAE
PURR_LACLA      -------------------------------------IGQIIAHEYHEKQVDVVMTIATKGIPIAQSVAE
APT_STRGB       -ELLASRIRDVADYPEPGVMFKD-ITPLLADPVAFTALTDTLAAGRRRHPRTKVVGLEARGFILGAPVAV
APT_PELUB       ------------------------------DADAFEECINQIIERSKNYKIDKIAAIESRGFVFASAVSY
APT_STRCL       -ELLLSRIRDVPDYPQPGVVFKD-ITPLLADPEAFSVLTEALAEVCVRHGATKVVGLEARGFILGAPVAV
APT_STRCO       ---------------------------------------------------TKVVGLEARGFILGAPVAL
APT_METTM       LDKLKESLRNSPVIKKG---EYDYFVNPVTDXXXXXXIADEIVRRFNPDPVDKIVCIEAMGIHHATVLSL
APT_METJA       ---------------------------------------------------TKLVTAEAMGIPLVTTLSL
APT_NOCSJ       --------------------------------------------------VDKVLGMESRGFILGAPVAL
APT_HERA2       ----------------------------------FDAAIEHFAQRYANQQLQAIVGIESRGFIFGAPLAL
APT_HALMA       --------------------------------------------------VDKIVTPAAMGIHISTAVSL
APT_DESAD       ---------------------------------------DQLAERFADYKIDKIAAAEARGFIFGAPLAT
APT_METTH       ----------------------------------------------------KIICIEAMGIHHATVLSL
APT_STRAW       -ELLLSRIRDVRDYPEPGVVFKD-ITPLLADPAAFTALTGALAELTVRHGATKIVGLEARGFILGAPAAV
APT_SHEPA       ---------------------------------------------YKDQGFTKVVGTEARGFLFGAPLAL
APT_TREDE       -KIIDAAIRRVPDFPKKGILFYD-ITGILVNPEVFSYCLDKMTEMYKDKKVDAVAAIEARGFIFAAPFAY
APT_SHEHH       ---------------------------------------------YKDQGFTKVVGTEARGFLFGAPLAL
APT_BACHD       ---------------------------------------DEMARFAKEKEVDLVVGPEARGFVVGCPIAY
APT_NITOC       ---------------------------------------------FLEQDITAVGGIEARGFIFGALVAW
APT_MARMS       --------------------------------------------------ITHIACIDARGFLIAAVLAY
APT_NITEU       --------------------------------------------------IDKVVGIESRGFIIAAPVAY
APT_CLOPS       --------------------------------DSVDQMAEFFK----DKNIDVVVGPEARGFIFGVPVAY
APT_CLOPE       --------------------------------DSVDQMAEFFK----DKNIDVVVGPEARGFIFGVPVAY
APT_CLOP1       --------------------------------DSVDQMAEFFK----DKNIDVVVGPEARGFIFGVPVAY
APT_ACTSZ       LDLIKSSIKSIPNYPKEGIIFRDITSLTEIP-EAFTATVNLIAEAFRHKGITKIIGTESRGFIFGAPVAV
APT_LACBA       ------------------------------DGQAFHAATDEIVAYAKDKDVEMVVGPEARGFIVGCPVAY
APT_SHELP       -----------------------------------------FVERYKDLGVTKVVGTEARGFLFGAPLAL
APT_DEBHA       ---------------SEGILFED-FLPVFTKPDLFQKLVRAFQLHVGEQKVDYVVGLESRGFLFGPTLAL
APT_PASMU       ----------------------------------FQTVVDLFVTRYKEKGITKVLGTESRGFIFGAPVAL
APT_KLEP7       ---------------------------------------------YKDAGITKVVGTEARGFLFGAPVAL
APT_BACSU       --------------------------------DVYRYATDQIVEYAKEKQIDLVVGPEARGFIIGCPVAY
APT_BACA2       --------------------------------DVYRYATDQIVEYAKEKEIDLVVGPEARGFIIGCPVAY
APT_LEUMM       ----------DGVAYKQAVDAIADFAKH-LNVDLI--AGPESRGFIVGSPL-------AYAMNIGFVPAR
APT_LACPL       -----------------------------------------------DKHVDMIVGPEARGFIVGCPVAY
APT_HALWD       --------------------------------------------------VDKIVTPAAMGIHISTAVSL
APT_HALSA       --------------------------------------------------VDKIVTPAAMGIHISTAVSL
APT_HALS3       --------------------------------------------------VDKIVTPAAMGIHISTAVSL
APT_ACTPJ       -----------------------------------DAIVAEFK----DKGITKVVGTESRGFIFGAPVAL
APT_ACTP7       -----------------------------------DAIVAEFK----DKGITKVVGTESRGFIFGAPVAL
APT_ACTP2       -----------------------------------DAIVAEFK----DKGITKVVGTESRGFIFGAPVAL
APT_THEFY       --------------------------------------------------IDLVAGLEARGFIFAAPVAV
APT_MAGSA       ------------------------------------AMGRMAREIIKFQPDV-LAGIDSRGFLVAAPLAL
APT_STACT       ---------------------------------------------------------EARGFIIGCPVAY
APT_SHEWM       ---------------------------------------------YKDHGFTKIVGTEARGFLFGAPLAL
APT_PROM4       -----------------------------------------------------IVSIDARGFIFGTAISM
APT_NITEC       ---------------------------------------DEIAERYRAEKIDKVVGIESRGFIFAAPVAY
APT_STAES       ---------------------------------------------------------EARGFIIGCPVAY
APT_STAEQ       ---------------------------------------------------------EARGFIIGCPVAY
APT_SHEFN       ---------------------------------------------------TKVVGTEARGFLFGAPLAL
APT_KLEP3       ---------------------------------------------YKDAGITKVVGTEARGFLFGAPVAL
APT_GEOSM       ------------------------------DAKSFQRMVDLLSHRYVGQKIDKVVGVEARGFIIGAALAY
APT_GEOBB       ------------------------------DAKSFQRMVDLLSHRYVGQKIDKVVGVEARGFIIGAALAY
APT_ERWCT       ---------------------------------------------YRNTGVTKVVGTEARGFLFGAPVAL
APT_BACWK       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACHK       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACCZ       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACCR       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACCQ       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACC7       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACC4       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACC2       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACC1       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACC0       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACAN       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACAH       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACAC       ---------------------------------------------------------EARGFIIGCPVS-
APT_BACAA       ---------------------------------------------------------EARGFIIGCPVS-
APT_SODGM       ---------------------------------------------FRDAGLTKIVGTEARGFLFGTPVAL
APT_RHORT       --------------------------------------------------------IESRGFLVAAPLAL
APT_PHOLL       ---------KPGVLFRDITTLLDNPLAYQATIDLL-------VERYQGKGITKIVGTEARGFLFGAPVAL
APT_MANSM       --------------------------------------------------ITKVVGTESRGFIFGAPVAL
APT_CHLAA       --------------------------NGQAFSEVIDRLHERYQNQQIDA----VVGIESRGFIFSAPLAY
APT_BACLD       ---------------------------------------------------------EARGFIIGCPVAY
APT_BACCN       ----------------------------------YKAATDEIVAYAKERNIDLVVGPEARGFIIGCPVS-
APT_SALG2       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_PECCP       ---------------------------------------------YRNSGVTKVVGTEARGFLFGAPVAL
APT_LEPBL       -----------------------------------------FVNRYQDKGITKVAGIEARGFLTGAPLAF
APT_LEPBJ       -----------------------------------------FVNRYQDKGITKVAGIEARGFLTGAPLAF
APT_LACS1       ------------------------------DISPLMADGEAYRQAFADKGVEMIVGPEARGFIVGCPVAY
APT_HAEIE       ---------------------------------------------YRDKGITKVLGTESRGFIFGAPVAL
APT_BACP2       --------------------------------------------------IDLIVGPEARGFIIGCPVAY
APT_SALTY       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALTI       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALSV       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALPK       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALPC       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALPB       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALPA       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALNS       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALEP       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALDC       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALCH       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SALA4       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_RHOOB       --------------------------------------------LAACAPATEVIAVDARGFLLGGGVAR
APT_PEDPA       -----------------------------------------------DKGVEMIVGPEARGFIVGCPVAY
APT_STRU0       ----------------------------------------------ADKEIDMIVGPEARGFIIGCPVAV
APT_SALHS       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_MARMM       ---------------------------------------------WAGAKIDKVAGTEARGFILGGAVAH
APT_LACLA       ------------------------------DGNAYNYAATEIVQYARDKEIDMVVGPEARGFIIGCPVA-
APT_IDILO       --------------------------------DAFRLTINTLKQRYAGQGITQIAAVEARGFIFGSALAY
APT1_YEAST      ---------------SEGILFEDFFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLAL
PYRE_PELTS      --------------------------------DYSELLCRELAARFAGDGISVVIGPAMGGIIVSYEVAR
APT_TREPS       ---LDRAIRKRIDFPKKGILYYD-ITGVLMNAAVFRYCLDQMVEFYRDEHVTAVAAIESRGFIFAAPFAD
APT_TREPA       ---LDRAIRKRIDFPKKGILYYD-ITGVLMNAAVFRYCLDQMVEFYRDEHVTAVAAIESRGFIFAAPFAD
APT_STRSY       ----------------------------------------EIVQYATDKQIDMIVGPEARGFIVGCPVAF
APT_STRS2       ----------------------------------------EIVQYATDKQIDMIVGPEARGFIVGCPVAF
APT_STRGC       ----------------------------------------EIVQYATDKKIDMVVGPEARGFIVGCPVAF
APT_STAAW       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAU       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAT       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAS       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAR       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAN       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAM       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAE       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAC       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAAB       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAA9       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAA8       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAA3       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAA2       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_STAA1       -----------------------------------------------DRDVDIVVGPEARGFIIGCPVAY
APT_SALAR       ---------------------------------------------YKKAGITKVVGTEARGFLFGAPVAL
APT_OCEIH       ---------------------------------------------------------EARGFIVGCPVS-
APT_METKA       ----------------------------ELPPELLREVAYRIVRALDSTDFDKIVCVEAMGIHLGALLSD
APT_LACLM       ------------------------------DGNAYNYAATEIVQYARDKEIDMVVGPEARGFIIGCPVA-
APT_EXIS2       ---------------------------------------------------------EARGFVVGCPAAY
APT_STRSV       ----------------------------------------EIVQYATDKKIDMIVGPEARGFIVGCPVAF
APT_MACCJ       ---------------------------------------------------------EARGFIIGCPVA-
APT_GEOSW       ---------------------------------------------------------EARGFIIGCPVAY
APT_CLOK5       ------------------------------DKDAFKYAVDKIAGYLKDKNIDVVVGPEARGFLFGAPIAY
APT_CLOK1       ------------------------------DKDAFKYAVDKIAGYLKDKNIDVVVGPEARGFLFGAPIAY
APT_CLOB8       ---LQEKIRVIENFPKEGI----SFKDITTLIADGEALRETINRILEDKKIDLIVGPEARGFIFGVPVAY
PYRE_CHLPD      ---------------------------------------------FSQKGVDTVISPAIGGIVAGTETGR
APT_STRPZ       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRPM       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRPG       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRPF       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRPD       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRPC       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRPB       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRP8       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRP6       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRP3       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRP1       ----------------------------------------EIAQYACDKDIDMVVGPEARGFIIGCPVAV
APT_STRA1       ----------------------------------------EIVQYAADKDIDMIVGPEARGFIVGCPVAY
APT_STAS1       ---------------------------------------------------------EARGFIIGCPVAY
APT_SHESH       -----------------------------------DILVEKYK----DQGFTKVVGTEARGFLFGAPLAL
APT_RUBXD       -----------------------------------DALAEATRSLDYD----RVISAEARGFVFGTALAY
APT_LEUCK       ----------DGVAYKQAVDAIADFAK-DLNVDLI--AGPESRGFIVGSPL-------AYALNIGFVPAR
APT_LACLS       ------------------------------DGNAYNYAATEIVQYARDKEIDMVVGPEARGFIIGCPVA-
APT_HAEIN       ---------------------------------------------YRDKGITKVLGTESRGFIFGAPVAL
APT_HAEIG       ---------------------------------------------YRDKGITKVLGTESRGFIFGAPVAL
APT_HAEI8       ---------------------------------------------YRDKGITKVLGTESRGFIFGAPVAL
APT_ENTS8       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ENT38       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ALKMQ       ---------------------------------------------------------EARGFLVGAPVAY
PYRE_YARLI      ----------------------------------------------------------------------
APT_VIBVY       ---------------------------------------------YKDMGFTKVVGTEARGFLFGAPLAL
APT_VIBVU       ---------------------------------------------YKDMGFTKVVGTEARGFLFGAPLAL
APT_STRZT       ----------------------------------------EIVQYATDKKIDMIVGPEARGFIVGCPVAF
APT_HAES2       --------------------------------------------------ITKVIGTESRGFIFGAPVAL
APT_HAES1       --------------------------------------------------ITKVIGTESRGFIFGAPVAL
APT_GEOTN       ---------------------------------------------------------EARGFIIGCPVAY
APT_GEOKA       ---------------------------------------------------------EARGFIIGCPVAY
APT_VIBHB       ---------------------------------------------YKDMGFTKVVGTEARGFLFGAPLAL
APT_STRZP       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_STRR6       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_STRPN       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_STRPJ       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_STRPI       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_STRP7       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_STRP2       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_STRMU       ----------------------------------------EIVQYATDKKIDMIVGPEARGFIVGCPVAY
APT_STRA5       ----------------------------------------EIVQYAADKDIDMIVGPEARGFIVGCPVAY
APT_STRA3       ----------------------------------------EIVQYAADKDIDMIVGPEARGFIVGCPVAY
APT_STAHJ       -----------------------------------------------DRDVDVVVGPEARGFIIGCPVAY
APT_SHIFL       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SHIF8       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_FUSNN       ---------------------------------------EKIVEFAKDHHIDIVVGPEARGFIFGCPVSY
APT_CORJK       ----------------------------------------------------------------------
APT_ASHGO       ----------------EGVLFEDFFRSPQLFQKLIDAFKMHLAEAFPETKIDYLVGLESRGFLFGPSLAL
PYRE_PROA2      --------------------------------------------------IDTVISPAIGGIVVGTEVGR
APT_VIBPA       ---------------------------------------------YKDMGFTKVVGTEARGFLFGAPLAL
APT_STRS7       ----------------------------------------EIVQYACDKDIDMIVGPEARGFIIGCPVAV
APT_STREM       ----------------------------------------EIVQYACDKDIDMIVGPEARGFIIGCPVAV
APT_STRE4       ----------------------------------------EIVQYACDKDIDMIVGPEARGFIIGCPVAV
APT_SHISS       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SHIDS       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SHIBS       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SHIB3       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_SHEDO       ------------------------------DASAYQATIALFVEKYQGMGFTKVVGTEARGFLFGAPLAL
APT_KOSOT       ------------------------------DPGAFKVCISSLKELVKDFEFNLIVAPEARGFIFAAPLAL
APT_ESCF3       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_EDWI9       LEFLKQNIKTIPDYPKPGILDVTSLLEYALSIELLAAR-------YRAAGITKVVGTEARGFLFGAPVAL
APT_ECOUT       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOSM       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOSE       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOLU       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOLI       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOLC       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOL6       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOL5       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOK1       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOHS       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECODH       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECOBW       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECO8A       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECO81       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECO7I       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECO55       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECO45       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECO27       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_ECO24       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_CITK8       ---------------------------------------------YKNAGITKVVGTEARGFLFGAPVAL
APT_AERHH       --------------------------------DAFKATIDLLANHYRDQGITKIVGTEARGFIFGAPVAY
PYRE_THETH      --LLEGHFLLRSGMHSPFFLQSAALLQHPL---YAEAVGEALGKLFEDEKVDFVIAPAIGGVVLSFVVAK
PYRE_THET8      --LLEGHFLLRSGMHSPFFLQSAALLQHPL---YAEAVGEALGKLFKDEKVDFVIAPAIGGVVLSFVVAK
PYRE_THET2      --LLEGHFLLRSGMHSPFFLQSAALLQHPL---YAEAVGEALGKLFEDEKVDFVIAPAIGGVVLSFVVAK
PYRE_SERP5      ----------------------------------------------------------------------
APT_YERE8       ---------------------------------------------YLDKGVTKVVGTEARGFLFGAPVAL
APT_STRTD       ----------------------------------------EIVQYATDKKIDMIVGPEARGFIVGCPVAF
APT_STRT2       ----------------------------------------EIVQYATDKKIDMIVGPEARGFIVGCPVAF
APT_STRT1       ----------------------------------------EIVQYATDKKIDMIVGPEARGFIVGCPVAF
APT_PROM0       -----------------------------------------------------ILAIDARGFLFGSVIAY
APT_LACC3       -----------------------------------------------DKGVEMIVGPEARGFIVGCPVAY
APT_ENTFA       --------------------------------------------------IDMVVGPEARGFIVGCPVAY
APT_CLOBB       ----------------------------------------------------------------------
APT_CLOBA       ----------------------------------------------------------------------
PUR1_SHIFL      ----------------------DSFIDYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIAR
PUR1_ECOLI      ----------------------DSFIDYSARVNMGTKLGEKIAREWEDLDIDVVIPIPETSCDIALEIAR
APT_SOLUE       ----------------------------------FHGVIDGLKDHYRDIKVDTVLGIEARGFIFAPALAY
APT_PELCD       ------------------------------DAKSFHRMVDLIAHRYIGQKIDQIVGVEARGFILGAALAY
APT1_WHEAT      -----------------------------LDPQAFRDTTDLFVERYKDKDITVVAGVEARGFIFGPPIAL
PYRE_YERPY      ----------------------------------------------------------------------
PYRE_YERPS      ----------------------------------------------------------------------
PYRE_YERPP      ----------------------------------------------------------------------
PYRE_YERPN      ----------------------------------------------------------------------
PYRE_YERPG      ----------------------------------------------------------------------
PYRE_YERPE      ----------------------------------------------------------------------
PYRE_YERPB      ----------------------------------------------------------------------
PYRE_YERPA      ----------------------------------------------------------------------
PYRE_YERP3      ----------------------------------------------------------------------
APT_VIBCM       ------------------------------DAQAYQATIQLLVEKYKDMGFTKVVGTEARGFLFGAPLAL
APT_VIBCH       ------------------------------DAQAYQATIQLLVEKYKDMGFTKVVGTEARGFLFGAPLAL
APT_VIBC3       ------------------------------DAQAYQATIQLLVEKYKDMGFTKVVGTEARGFLFGAPLAL
APT_STRP4       ----------------------------------------EIVQYATDKKVDMIVGPEARGFIVGCPVAF
APT_SHESR       LSLIKQSIKTIPNYPKEGILDVTSLLENAVAYKAIDLLVEQYR----NKGFTKIVGTEARGFLFGAPLAL
APT_SHEAM       ---------------------------------------------YKDSGFTKVVGTESRGFLFGAPLAL
APT_RHOSR       -----------------------------------------------------IAAVDARGFLLGGGVAR
APT_RENSM       -----------------------------------DALVEPFAGQF-DA----VAGVEARGFLLXXXXXX
APT_COPPD       --------------------------------------------------VTAVAAVEARGFIWGGTLAY
APT_ACHLI       -----------------------------LDGKAFKYASDQFTEFARSKKADLIVGPEARGFIFGCPVAV
PYRE_THEMA      -----------------------------------DVVGEELAKLLKKYDVETVVGPAMGGVILSYVVAR
PYRE_ACTSZ      ----------------------------------------------------------------------
APT_YERPY       ----------------------------------YSASIELLSEHYSESGVTKVVGTEARGFLFGAPVAL
APT_YERPS       ----------------------------------YSASIELLSEHYSESGVTKVVGTEARGFLFGAPVAL
APT_YERPB       ----------------------------------YSASIELLSEHYSESGVTKVVGTEARGFLFGAPVAL
APT_YERP3       ----------------------------------YSASIELLSEHYSESGVTKVVGTEARGFLFGAPVAL
APT_VIBF1       ------------------------------DPKAYQATIQSLVEKYKQGGFTKIVGTEARGFLFGAPLAL
APT_SERP5       ---------------------------------------------FREAGVTKVVGTEARGFLFGAPVAL
APT_PSEU2       ---------------------------------------DSFVQRYIDAEFSHIGVMDARGFLIGSVVAY
APT_PROMP       -----------------------------------------------------LISIDARGFIFGSAISF
APT_NITMS       ------------------------------DPSAMESIADEFSKYFHPKNIDIFAGIESRGFILACILAT
APT_CANAL       ----------------EGILFED-FLPIFTKPDLFNKLVKAFKLHVGEQKIDYVIGLESRGFLFGPTLAL
APT_AERS4       ---------------------------------------------YRDQGITKIVGTEARGFIFGAPVAF
PYRE_YERE8      ----------------------------------------------------------------------
PYRE_RHIME      ---------------------------------------------------------ETAGIPFAAMLAE
APT_YERPP       ---------------------------------------------YSESGVTKVVGTEARGFLFGAPVAL
APT_YERPN       ---------------------------------------------YSESGVTKVVGTEARGFLFGAPVAL
APT_YERPG       ---------------------------------------------YSESGVTKVVGTEARGFLFGAPVAL
APT_YERPE       ---------------------------------------------YSESGVTKVVGTEARGFLFGAPVAL
APT_YERPA       ---------------------------------------------YSESGVTKVVGTEARGFLFGAPVAL
APT_UREPA       -----------------------------LEPKIIEKIVDDFADFAKSLNIDAIIGAESRGFLFAAPLSI
APT_UREP2       -----------------------------LEPKIIEKIVDDFADFAKSLNIDAIIGAESRGFLFAAPLSI
APT_SYNPW       ----------------------------------------------------------------------
APT_SHESM       LSLIKQSIKTIPNYPKEGILDVTSLLENAAAYKAIDLLVEQYR----NKGFTKIVGTEARGFLFGAPLAL
APT_SHESA       LSLIKQSIKTIPNYPKEGILDVTSLLENAAAYKAIDLLVEQYR----NKGFTKIVGTEARGFLFGAPLAL
APT_SHEPW       ---------------------------------------------YKEQGFTKVVGTEARGFLFGAPLAL
APT_EXISA       ---------------------------------------------------------EARGFVVGCPAAY
APT_ECO5E       ---------------------------------------------YKNAGINKVVGTEARGFLFGAPVAL
APT_ECO57       ---------------------------------------------YKNAGINKVVGTEARGFLFGAPVAL
APT_CARHZ       ---------------------------------------------------THVVAIESRGFMFGAPLAY
APT_ACIC1       ---------------------------------VFAAVVDALVRDYQHGTVDKVVGIEARGFIVAAPVAY
PYRE_VESOH      ----------------------------------------------------------------------
APT_SHESW       ---------------------------------------------------TKIVGTEARGFLFGAPLAL
APT_SHEPC       ---------------------------------------------------TKIVGTEARGFLFGAPLAL
APT_SHEB9       ---------------------------------------------------TKIVGTEARGFLFGAPLAL
APT_SHEB8       ---------------------------------------------------TKIVGTEARGFLFGAPLAL
APT_SHEB5       ---------------------------------------------------TKIVGTEARGFLFGAPLAL
APT_SHEB2       ---------------------------------------------------TKIVGTEARGFLFGAPLAL
APT_SACEN       --------------------------------------------------------VEARGFLLGAAVAQ
APT_PROMA       --------------------------------DLYQELIEEMAKSEILNSSDAIISIDARGFLFGSCISL
APT_MYCS5       ----------------------------------------------------------------------
APT_CLOCE       ----------------------------------------------------------------------
APT_BLOPB       --------------------------------------------------LTKVVGIEARGFLFSAPLAL
APT_ACIC5       ---------------------------------LIDALAEHY----IGKNIDLVLGIEARGFIFGPALAY
UPP_COREF       ----------------------------------------------------------------------
PYRE_XANCP      --------------------------------DAIDAAGVEFDLLFG--PAYKGIPLATA---LACAYAR
PYRE_XANCB      --------------------------------DAIDAAGVEFDLLFG--PAYKGIPLATA---LACAYAR
PYRE_XANC8      --------------------------------DAIDAAGVEFDLLFG--PAYKGIPLATA---LACAYAR
PYRE_SINMW      ---------------------------------------------------------ETAGIPFAAMLAE
PYRE_BACHD      ----------------------------------------------------------------------
APT_SYMTH       ----------------------------------------------------------------------
APT_PSESM       ---------------------------------------DSFVQRYIDADFSHIGVMDARGFLIGSVVAY
APT_PSE14       ---------------------------------------DSFVQRYIEADFSHIGVMDARGFLIGSVVAY
APT_PROAC       ----------------------------------------------ASRDVDVVLGMEARGFMFAGPVAL
APT_MESFL       ------------------------------DADAFAYVIDEMAKFVIECGANVVVAPEARGFLFASAVAY
APT_BIFLO       -----------------------------------------------------IAGLESRGFLFGPVMAA
PYRE_THETN      -------------------------------------LAEKFKGYRIDVVIGPAI----GGIILAYEVAR
PYRE_AERS4      ----------------------------------------------------------------------
APT_LISW6       ---------------------------------------------------------EARGFIIGCPVAY
APT_LISMO       ---------------------------------------------------------EARGFIIGCPVAY
APT_LISMH       ---------------------------------------------------------EARGFIIGCPVAY
APT_LISMF       ---------------------------------------------------------EARGFIIGCPVAY
APT_LISMC       ---------------------------------------------------------EARGFIIGCPVAY
APT_LISIN       ---------------------------------------------------------EARGFIIGCPVAY
APT_LACSS       --------------------------------------------------VEMIVGPEARGFIVGCPVAY
APT_GEOUR       ------------------------------DAASYQRMVDLLSHRYIGKKIDKVVGVEARGFIIGAALAY
APT_GEOLS       ------------------------------DAKSFTRMIDMIANRYIGQRIDKVVGVEARGFLIGAALAY
APT_COLP3       ----------------------------------------------------------------------
APT_ALISL       ---------------------------------------------------TKIVGTEARGFLFGAPLAL
PYRE_THESQ      -----------------------------------DIVGEELAKLLRKYDVETVVGPAMGGVILSYVVAR
PYRE_THEP1      -----------------------------------DIVGEELAKLLRKYDVETVVGPAMGGVILSYVVAR
PYRE_THENN      -----------------------------------DIVGEELAKLLRKYDVETVVGPAMGGVILSYVVAR
APT_PSEHT       --------------------------------DAFKATIDAFIAAYKDQGFTKIIGTESRGFIFGAPLSY
APT_PROMM       ----------------------------------------------------------------------
APT_PROM3       ----------------------------------------------------------------------
APT_GEOSF       --------------------------------------------------IDKVVGVEARGFIIGAALAY
APT_CLONN       ----------------------------------------------------------------------
APT_ANAVT       ----------------------------------------------------------------------
APT_ANASP       ----------------------------------------------------------------------
APT_ANADF       ----------------------------------------------------------------------
PYRE_RHISN      ---------------------------------------------------------ETAGIPFAAMLAE
APT_LACJO       ---------------------------------------------------------EARGFIVGCPVAT
APT_BRASO       ------------------------------DARAFRRAVDELVHPWAGSKIDKVAGIEARGFILGGAVAH


                         .         .         *         .         .         .         .:140
query           HFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIELV
XPT_CLOPH       YFNVPVVFAKKAQSINIEGEVFATKIESFTHKKTYDVIVSKKFLKPSDRVLIIDDFLANGCALVGLIDLV
XPT_BIFLO       HFGVPVVFAKKAQSINLDGDQYTTTVYSFTKQKEFPVIVAKKYLNAGDHVLLIDDFLANGKALRGLIDLC
XPT_BIFLD       HFGVPVVFAKKAQSINLDGDQYTTTVYSFTKQKEFPVIVAKKYLNAGDHVLLIDDFLANGKALRGLIDLC
XPT_BIFAA       HFGVPVVFAKKAQSINLDGDQYTTTVYSFTKQKEFPVIVSKRYLNEGDHVLLIDDFLANGKALKGLIELC
XPT_BIFLI       HFGVPVVFAKKAQSINLDGDQYTTTVYSFTKQKEFPVIVAKKYLNAGDHVLLIDDFLANGKALRGLINLC
XPT_BIFA0       HFDVPVVFAKKAQSINLDGEQYVTHVYSFTKQKEFPVIVSKKYLNAGDRVLLIDDFLANGKALNGLIELC
XPT_CLOCE       YFNVPVIFAKKTESRNLDSDAYLSEVFSFTKGKTYTIRVSKNYLNSEDTILIIDDFLANGKAALGLAHIV
XPT_CLONN       YFNVPVVFAKKHQGSNMDENTYESEVFSFTKNKSYKVRVSKKYINTEDKVLIIDDFLANGNAACGLIDIV
XPT2_CLOBL      YFDFPVVFAKKVDAANMDKDTYESKVHSFTKNKTYNVRVSKKYINKGDKILLIDDFLANGCAALGLIDII
XPT2_CLOBH      YFDFPVVFAKKVDAANMDKDTYESKVHSFTKNKTYNVRVSKKYINKGDKILLIDDFLANGCAALGLIDII
XPT2_CLOB1      YFDFPVVFAKKVDAANMDKDTYESKVHSFTKNKTYNVRVSKKYINKGDKILLIDDFLANGCAALGLIDII
XPT_LACSS       AFHVPVVFARKHKSLTLQDNMYSATVYSYTKKVNNHISISKKFLNENDRVLVIDDFLANGQAVEGLLEII
XPT_ALKMQ       YFNVPVVFAKKTQSKNLDQDTYEGEVYSYTKGQAYKIRVSKRYLHEKENILIIDDFLANGEALQGLREIV
XPT_CLOD6       YFNAPVVFAKKSESKNLDKDVYETNVYSFTKAREYSVKVSKKYINKGENILIVDDFLANGRAALGLKDLI
XPT_PSE14       NMGVPVIFARKHQSLTLTENLLSATVYSFTKQVESTVAISPRHLSSDDHVLIIDDFLANGKASQALISII
XPT_FINM2       RFNCPVVFAKKTSSKTLGDNCYRTEVFSFTKNRSYEVMVSKEYLDEKDHVLLIDDFLANGKALEGLIDIC
XPT_LACCB       EFHKPLVFARKHKSLTLKDHLYTATVYSFTKKTSNEIAISRKFLSADDNVLIIDDFLANGQAVEGLMDII
XPT_LACC3       EFHKPLVFARKHKSLTLKDHLYTATVYSFTKKTSNEIAISRKFLSADDNVLIIDDFLANGQAVEGLMDII
XPT_BACSK       SLQVPLIFARKKKSVTMDKEVYSSRVYSFTKKEYSEVTVSKDWLCPGDRVLIIDDFLANGQAATGLTQIV
XPT_PSEU2       NMGVPVIFARKHQSLTLTENLLTASVYSFTKQVESTVAISPRHLSSDDNVLIIDDFLANGKASQALISII
XPT_PSEPK       KLGVPVIFARKHQSLTLTENLLTASVYSFTKQTENTVAISPRHLNSSDRVLVIDDFLANGKASQALISII
XPT_PSEPG       KLGVPVIFARKHQSLTLTENLLTASVYSFTKQTENTVAISPRHLNSSDRVLVIDDFLANGKASQALISII
XPT_PSEP1       KLGVPVIFARKHQSLTLTENLLTASVYSFTKQTENTVAISPRHLNSSDRVLVIDDFLANGKASQALISII
XPT_MOOTA       SLKVPVVFAKKKQPSTMDGETYCGRVRSFTKEEVIDIVVAGSYLGPEDRVLIIDDFLASGEAARGLLKII
XPT_PSESM       NMGVPVIFARKHQSLTLTENLLSATVYSFTKQVESTVAISPRHLNSTDNVLIIDDFLANGKASQALISII
XPT_PSEE4       KLGVPVIFARKHQSLTLTENLLTASVYSFTKQTENTVAISPRHLNSSDRVLVIDDFLANGKASQALISII
XPT_CLOTE       YFNVPVVFAKKHAGSNMGENVYESKVYSFTKDIEYTIKVSKDYIDKEDNILIIDDFLASGSAMSGLIDIA
XPT_OCEIH       ELDVPVIFARKRKSLTLTDHLFTAEVYSYTKKTSNEISVSKDFLHEDDIVLVMDDFLANGQAALGLLEIA
XPT_LARHH       YFGVPVVFGKKTQSLNLDAEAFESEVYSYTKQTSYKVRVSKRYLRPGEQVLIIDDFLANGAAASGLIDIV
XPT_ENTFA       KLGVPMIFARKAKSLTMDEELLTASVYSFTKQVTSQISISRKFLSDADKVLIIDDFLANGQAAKGLVELC
XPT_PSEAE       ELGVPVIFARKYQSLTLKDNLYISKVFSFTKQTESTIAISAKHLNAHDHVLVIDDFLANGHAAKALIDLI
XPT_PSEAB       ELGVPVIFARKYQSLTLKDNLYISKVFSFTKQTESTIAISAKHLNAHDHVLVIDDFLANGHAAKALIDLI
XPT_PSEA8       ELGVPVIFARKYQSLTLKDNLYISKVFSFTKQTESTIAISAKHLNAHDHVLVIDDFLANGHAAKALIDLI
XPT_LACS1       VMKLPVVFARKHKSLTLVDNLYTSDVYSYTKKVTNTISVDKKFLTSDDKVLVIDDFLANGQAVQGIFNIC
XPT_PSEA7       ELGVPVIFARKYQSLTLKDNLYISKVFSFTKQTESTIAISAKHLNAHDHVLVIDDFLANGHAAKALIDLI
XPT_PSEU5       ELGVPVIFARKHQSLTLHDNLLTATVYSFTKQVESTIAVSTQHLSANDRVLIIDDFLANGKAAKGLISII
XPT_BACV8       LLELPVVFAKKKKPVTMEN-MLTTSVYSFTKDRSYDVCVSKDFLSKGDRVLFIDDFLANGNAAKGIIDLV
XPT_ACIAD       ELGVPVIFARKYQSLTLKDDLYRSKVFSFTKQVESTIAISNKHINAEDKVLVIDDFLANGQAALGLIDLI
XPT_ACIBT       ELGVPVIFARKYQSLTLKDDLYRAKVFSFTKQTESTIAISNKHINSSDKALVIDDFLANGQAALGLIDLI
XPT_ACIBC       ELGVPVIFARKYQSLTLKDDLYRAKVFSFTKQTESTIAISNKHINSSDKALVIDDFLANGQAALGLIDLI
XPT_ACIB5       ELGVPVIFARKYQSLTLKDDLYRAKVFSFTKQTESTIAISNKHINSSDKALVIDDFLANGQAALGLIDLI
XPT_ACIB3       ELGVPVIFARKYQSLTLKDDLYRAKVFSFTKQTESTIAISNKHINSSDKALVIDDFLANGQAALGLIDLI
XPT_BACCN       ELGVKVIFARKRKSLTLQENMYVANVYSFTKQETNEISLSKKHIHEDDRVLIIDDFLANGQAALGLMSLV
XPT_LACBA       HLNVPVIFARKHKSLTLTDNLYTAKVYSYTKQVTNEISIDRRFLAADDRVLIIDDFLANGQAVQGLLDIA
XPT_STRPS       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_PSEPF       NLGVPVIFARKQQSLTLTENLLSATVYSFTKKTESTVAISPRHLTSSDRVLIIDDFLANGKASQALISII
XPT_PSEF5       NLGVPVIFARKHQSLTLTENLLSATVYSFTKQVESTVAISPRHLTSSDRVLIIDDFLANGKASQALISII
XPT_STRZT       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRSV       ALGLPMIFAKKAKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLNSDDKVLIIDDFLANGQAAKGLITII
XPT_PSEFS       NLGVPVIFARKQQSLTLTENLLSATVYSFTKKTESTVAISPRHLTSSDRVLVIDDFLANGKASQALISII
XPT_STRZJ       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRR6       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRPJ       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRPI       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRP7       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRP4       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRP2       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRA5       ALGVPMIFAKKAKNITMTEGILTAEVYSFTKQVTSQVSIVSRFLSNDDTVLIIDDFLANGQAAKGLLEII
XPT_STRA3       ALGVPMIFAKKAKNITMTEGILTAEVYSFTKQVTSQVSIVSRFLSNDDTVLIIDDFLANGQAAKGLLEII
XPT_STRA1       ALGVPMIFAKKAKNITMTEGILTAEVYSFTKQVTSQVSIVSRFLSNDDTVLIIDDFLANGQAAKGLLEII
XPT_STRZP       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_BACHD       HLGVPFIFARKKKPLTMTDNVYRSQVYSFTKQETNEITVSKDLLHADDRVLIIDDFLANGQAAFGLCEIV
XPT_STRPN       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAEKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_STRGC       ALGVPMIFAKKAKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSPSDKVLVIDDFLANGQAAKGLVEII
XPT_STRU0       ALKVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIASKFLSKDDKVLIIDDFLANGQAAKGLIEII
XPT_LACPL       AMHVPVVFARKHKSVTLIDDLYTAEVYSYTKKTSNHISIAKKFLQADDQVLLIDDFLANGQAVQGMFEIC
XPT_BREBN       ALGVPFIYAKKKKAVTLTEEVYSAPVHSFTRQETYQISVSRQYLSKEDRVLIVDDFLATGAALVGLTNIV
XPT1_CLOBL      QMNLPMVILKKQASKILNGDVYQTTVHSFTKGLDYELTLSKKYINKEDNILIIDDFLANGEAALGAARLV
XPT_PSEMY       ELGIPVIFARKFQSLTLKDDLLISKVFSFTKQTESTIAISARHLTAADKVLVIDDFLANGHAAKALIDLI
XPT_BACLD       KLGVPVVFARKRQSLTLTENLLTASVYSFTKKTESTVAVSASHLSKDDKVLIIDDFLANGQAAKGLVSII
XPT_STAAR       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT1_CLOPS      YFDVPVVFAKKTESLNLDKDVYESNVHSFTKKKDYKVRVGKQFLNKGERVLIIDDFLAQGCATKGMIDLV
XPT1_CLOPE      YFDVPVVFAKKTESLNLDKDVYESNVHSFTKKKDYKVRVGKQFLNKGERVLIIDDFLAQGCATKGMIDLV
XPT1_CLOP1      YFDVPVVFAKKTESLNLDKDVYESNVHSFTKKKDYKVRVGKQFLNKGERVLIIDDFLAQGCATKGMIDLV
XPT_BACA2       ELGVPVIFARKRKSXXXXXXXXXASVYSFTKKTESQIAISGNHLSKDDRVLIIDDFLANGQAAEGLLSIV
XPT_EXIS2       RLGVPMVYARKTKSLTLNEGTISAEVYSFTKQQTSTITVAEQYLQAGERVLIIDDFLANGEAAFGLAKLV
XPT_STAS1       HFDVPCLFAKKAKPSTLKKGVYQAEIHSFTKNTTSTVVVSDEFLGENDRVLIIDDFLANGDASLGLNEIV
XPT_STAES       HFDVPCLFAKKAKPSTLKDGFYSTDIHSFTKNKTSTVIVSEEFLGADDKVLIIDDFLANGDASLGLNDIV
XPT_STAEQ       HFDVPCLFAKKAKPSTLKDGFYSTDIHSFTKNKTSTVIVSEEFLGADDKVLIIDDFLANGDASLGLNDIV
XPT_STACT       KFGVPCLFAKKAKPNTLNKGFYQTDIHSFTKDKTNSVIISEEFLDEHDRVLIIDDFLANGDASLGLNRLV
XPT_STAAW       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAAT       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAAS       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAAN       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAAM       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAAE       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAAC       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAAB       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIT
XPT_STAA9       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAA8       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAA3       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAA2       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_STAA1       HFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIA
XPT_LISMO       ALSVPVVFARKKKSVTLTDNLFTSTVYSYTKKESNDISVSKQFLTADDTILVIDDFLANGQAALGLLEIA
XPT_LISMF       ALSVPVVFARKKKSVTLTDNLFTSTVYSYTKKESNDISVSKQFLTADDTILVIDDFLANGQAALGLLEIA
XPT1_CLOBH      QMNLPMVILKKQASKILNGDVYQTTVHSFTKGLDYELTLSKKYIAKEDNILIIDDFLANGEAALGAARLV
XPT1_CLOB1      QMNLPMVILKKQASKILNGDVYQTTVHSFTKGLDYELTLSKKYIAKEDNILIIDDFLANGEAALGAARLV
XPT_CLOB8       QMNLPMVTLKKQNSKILNGDVYQTTVHSFTKSLDYELTLSKKYINDEDNILVIDDFLANGEAALGAARLI
XPT_LISMC       ALSVPVVFARKKKSVTLTDNLFTSTVYSYTKKESNDISVSKQFLTVDDTILVIDDFLANGQAALGLLEIA
XPT_MACCJ       KFKVPCLFAKKSVPSTLTEEVYHTDIHSYTKNKTSHVVVSKRFLSENDRVVIIDDFLANGEAALGLYNLV
XPT_PEDPA       AMDVPVVFARKHKSLTLTDDLYTASVYSYTKQTSNQISISKRFIDEKDRVLIIDDFLANGQAVSGLLDIA
XPT_LACLM       SLNVPMIFAKKAKNVTMNDDLLITEVYSFTKKLTSTVQISSKLIEEGDKVLIIDDFLANGQAALGLVHLM
XPT_STAHJ       HFDVPCLFAKKAKPSTLKDGFYSTDIHSFTKNKTSTVIVSEEFLNENDTVLIIDDFLANGDASLGLYDIA
XPT_LACLS       SLNVPMIFAKKAKNVTMNDDLLITEVYSFTKKLTSTVQISSKLIEEGDKVLIIDDFLANGQAALGLVHLM
XPT_EXISA       EMDIPFVFARKRKSLTLQDDLVEADVYSFTKQETNRISLSRRFVLPGERVLVIDDFLANGEAALGLTQLV
XPT_BACFR       LMDLPVVFAKKKSPRTIQNALSTT-VHSFTKDRDYEVVISSDFLTPKDNVLFVDDFLAYGNAALGVIDLI
XPT_BACFN       LMDLPVVFAKKKSPRTIQNALSTT-VHSFTKDRDYEVVISSDFLTPKDNVLFVDDFLAYGNAALGVIDLI
XPT_LACLA       SLNVPMIFAKKAKNVTMNDDLLITEVYSFTKKLTSTVQISSKLIEEGDKVLIIDDFLANGQAALGLVHLM
XPT_BACSU       KLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIV
XPT_GEOTN       ELGVPLVVARKRRPLTMTSEVYCAEVYSFTKKETNEIIVSRPLLDSSDRVLIIDDFLANGQAALGMVEVV
XPT_OENOB       QLQVPMIFARKHQSRTLNEEFFSASVYSYTKQTENQIAVSKRFINPGDRVLIIDDFLANGQAVQGLLDII
XPT_EUBR3       KMNVPLVILKKQPSKTLHNDLYQTQVTSFTTEKSYELTLSRDVISEDDNILLIDDFMADGEAATGAIRLL
XPT_STRTR       ALDVPMIFAKKAKNITMNEGILTAEVYSFTKQVTSTVSIASKFLTPEDKVLIVDDFLANGQAAKGLIQII
XPT2_CLOPS      YFNVPVVFGKKIERLNKREEVFNSEVYSFTKKTIYNVVVDKKFIKPGEKILIVDDFLANACAVFGLIDVV
XPT2_CLOPE      YFNVPVVFGKKIERLNKREEVFNSEVYSFTKKTIYNVVVDKKFIKPGEKILIVDDFLANACAVFGLIDVV
XPT2_CLOP1      YFNVPVVFGKKIERLNKREEVFNSEVYSFTKKTIYNVVVDKKFIKPGEKILIVDDFLANACAVFGLIDVV
XPT_PARD8       IMQLXXXXXXXXXXXTMEN-MLSTVVHSFTKDRDYTVCISNNFLTPEDHILFIDDFLAYGNAAMGMVELA
XPT_BACTN       LMDLPVVFAKKKSPKTIQNALSTT-VHSFTKDRDYEVVISADFLTPNDNVLFVDDFLAYGNAALGILDLI
XPT_LEUMM       ALHVPVVFARKNKSLTLPENVWTADVYSFTKQTTNHIMIDHRFLSAAENILIIDDFLANGQAVEGLLKIA
XPT_BACC2       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDENDRVLIIDDFLANGQAALGLMSLV
XPT_STRMT       ALNVPMIFAKKAKNITMNEGILTAQVYSFTKQVTSTVSIAGKFLSPEDKVLIIDDFLANGQAAKGLIQII
XPT_LACRJ       EMNLPVIFARKHKSLTLNQNMYTADVYSYTKKTTNRISISKKYVDADDKILMIDDFLANGQAVEGLLEIA
XPT_LACRD       EMNLPVIFARKHKSLTLNQNMYTADVYSYTKKTTNRISISKKYVDADDKILMIDDFLANGQAVEGLLEIA
XPT_BACWK       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDENDRVLIIDDFLANGQAALGLMSLV
XPT_BACCR       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDENDRVLIIDDFLANGQAALGLMSLV
XPT_BACC1       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_STRE4       ALEVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGGLLSKEDRVLIIDDFLANGQAAKGLIDII
XPT_BACHK       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACCQ       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACC7       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACC0       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACAN       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACAC       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACAA       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACCZ       ELGVKVIFARKRKSLTLQDNMYVASVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACC4       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDENDRVLIIDDFLANGQAALGLMSLV
XPT_STRS7       ALEVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGGLLSKEDRVLIIDDFLANGQAAKGLIDII
XPT_LACDB       CLGVPMVFARKKKPSTVTDAVYTAEVFSYTKQVTNTISVEAKFLDANDRILVIDDFLANGEAAKGLISLX
XPT_LACDA       CLGVPMVFARKKKPSTVTDAVYTAEVFSYTKQVTNTISVEAKFLDANDRILVIDDFLANGEAAKGLISLX
XPT_LACAC       QLGVPMVFARKKKPSTLNDAVYWADVFSYTKKVNSKICVEEKFLHEGENILIIDDFVAHGEAVKGMVNIA
XPT_BACC3       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_BACAH       ELGVKVIFARKRKSLTLQDNMYVANVYSFTKQETNEISLSRNHIDESDRVLIIDDFLANGQAALGLMSLV
XPT_AZOVD       ELDVPLVFARKHRSLTLTDDLLTARVYSFTKQVESTVAISASHLAAGERILIVDDFXXXXXXXXXXXXIV
XPT_PORGI       IMNLPVVFVKKKQPKTMD-NMLTTTVHSFTKSRDYTVCISHXXXXXXXXXXXXXXXXAYGNAAQGIIDLA
XPT_PORG3       IMNLPVVFVKKKQPKTMD-NMLTTTVHSFTKSRDYTVCISHXXXXXXXXXXXXXXXXAYGNAAQGIIDLA
XPT_LACF3       ALGVPVIFARKHKSLTLNSGMYTADVYSYTKKTTNRISISKRYVDKTDRVLLIDDFLANGQAVEGMLQIA
XPT_HELMI       XXXXXXXFAKKKQA-STQSDVYTSQIYSFTRQESVNITVSKKFLPADDVVLIVDDFLAHGEALKGLVDIV
XPT_LACH4       VLDVPMVFARKKKPSTLNDAVYWADVFSYTKKVNNKICVEEKLLHKGENLLIIDDFVAQGEAVKGMVNIA
XPT_DEIRA       ELGVPMVYARKKKPLTMSEQVYTAQSVSRTKGGTVDLFVSSEYLGPQDRVVVIDDFLASGGTLRSLSQII
XPT_BACP2       ALQVPVVFARKRQSLTLTENLLTASVYSFTKKVESTIAVSNTHLGEKDCVLIIDDFLXXXXXXXXXXXXX
XPT_LISW6       ALSVPVVFARKKKSVTLTDNLYTSTVYSYTKKESNDISVSKQFLTDADTILVIDDFLANGQXXXXXXXXX
XPT_DESRM       XXXXXXXXXKKKVPSTL-GDSYVSNIYSFTKNESVTVSVAKQYLKSDDKILIVDDFLARGEALKGLAHLV
XPT_STRPG       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVMSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_LISIN       ALSVPVVFARKKKSVTLTDNLYTSTVYSYTKKKSNDISVSKQFLTDADTILVIDDFLANGQXXXXXXXXX
XPT_STRPM       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRPF       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRPD       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRPC       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRPB       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRP8       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRP6       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRP3       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRP1       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_STRPZ       AMDVPMIFAKKHKNITMTEGILTAEVYSFTKQVTSTVSIAGKFLSKEDKVLIIDDFLANGQAAKGLIEXX
XPT_DEIGD       ALNVPLVYARKKKPITMQEPTFTAQSISRTKGGAVDLFVSSEYLGSGDRVVVIDDFLASGGTLRALAGII
XPT_DEIDV       VLGVPMVYARKKRPVTMQGPVYTAQSVSRTKGGVVELFVSHEYLSADDRVVVIDDFXXXXXXXXXXXXMI
XPT_LACJO       QLGVPMVFARKKKPSTLNDAVYWADVFSYTKKVNNKICVEKKXXXXXXXXXXXXXXXAHGEAVKGMLNIA
XPT_LACGA       QLGVPMVFARKKKPSTLNDAVYWADVFSYTKKVNNKICVEKKXXXXXXXXXXXXXXXAHGEAVKGMLNIA
XPT_CLOAB       QMDIPMVILKKQKPNTLTEDVYQTTVHSFTKGSDYELTXXXXXXXXXXXXXXXXXXXANGEASLGAVRLV
XPT_CLOBB       QMNLPMVILKKQGSKILKGDVYQTTVHSFTKGTDYELTLQKKYXXXXXXXXXXXXFLANGEAALGAARLX
XPT_CLOBA       QMNLPMVILKKQGSKILKGDVYQTTVHSFTKGTDYELTLQKKYXXXXXXXXXXXXFLANGEAALGAARLX
XPT_CHLSY       XXXXXXVYAKKYDP-DVPVPALTRHIHSPTRDRQVQLAISARFIPAGSRVAIVDDFLANGRTALALADMX
XPT_CHLAA       XXXXXXVYAKKYDP-DVPVPALTRHIHSPTRDRQVQLAISARFIPAGSRVAIVDDFLANGRTALALADMX
PURR_BACSU      YLNVPVVIVRKDNKVT-EGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLL
PURR_STRR6      VLNVSFVIVRRDLKITEGSTVSVNYVSGSSGDRIEKMFLSKRSLKAGSRVLIVDDFLKGGGTVNGMISLL
PURR_STRPN      VLNVSFVIVRRDLKITEGSTVSVNYVSGSSGDRIEKMFLSKRSLKAGSRVLIVDDFLKGGGTVNGMISLL
APT_DESMR       KMGLGFVPVRKPGKLPYKTVSVSYDLEYGSD----TLCMHEDALLRDEKVLVIDDLLATGGTLSGVIDLV
APT_META3       CTDIPYAIIRKRE-YKLDGEIAVHQETGYSKGELY-----LNGVNKGDKVIIVDDVLSTGGTIIALIEAL
APT1_METVS      ATDIPYVIMRKREYL-LEGEVPVHQETGYSKGELY-----LNGINKGDKVVILDDVISTGGTLVAIIRAL
APT1_METM7      ATDIPYVIMRKREYL-LEGEIPVHQETGYSKGELY-----LNGINKGDKVVILDDVISTGGTLVAIINAL
APT2_METM5      ATDIPYVIMRKREYL-LEGEIPVHQETGYSKGELY-----LNGINKGDKVVILDDVISTGGTLVAIINAL
APT1_METMP      ATDIPYVIMRKREYL-LEGEIPVHQETGYSKGELY-----LNGINKGDKVIILDDVISTGGTLVAIINAL
PURR_LACLM      ILDVPFVIVRRDPKVT-EGATLNVNYMSGSSSRVENMTLSKRSLSIGQNVLIVDDFMKGAGTINGMRSLV
PURR_LACLA      ILDVPFVIVRRDPKVT-EGATLNVNYMSGSSSRVENMTLSKRSLSIGQNVLIVDDFMKGAGTINGMRSLV
APT_STRGB       RAGLGFIPVRKAGK--LPGATLSQAYD-LEYGSA-EIEVHAEDLAAGDRVLIVDDVLATGGTAEAAIQLI
APT_PELUB       LLKKPFIMFRKKNKLPAETHSVDFELEYGTA----TIEVHKDSIDKDDSVLIIDDLIATGGTAEAAAKLV
APT_STRCL       RAGLGFIPIRKAGK--LPGATLS-QAYALEYGTA-EIEVHAEDLTPDDRVMVIDDVLATGGTAAAAMELI
APT_STRCO       RAGLGFIPVRKAGK--LPGATLSQAYD-LEYGSA-EIEVHAEDLTAGDRVLVVDDVLATGGTAEASLELI
APT_METTM       KTRIPFVVVRKRR-YGLPGEVAVHQMTGYSEGELYI-----NGVDGDDRVMVIDDVVSTGGTLLAVLEAL
APT_METJA       YTDIPYVIMRKRE-YKLPGEIPVFQSTGYSKGQLYLNGIEK-----GDKVVIIDDVISTGGTMIAIIDAL
APT_NOCSJ       ALGVGFVPVRKAGKLPRATYAVSYALE---YGEA-TLEVHQDALEPGDRVLLVDDVLATGGTARATIDLV
APT_HERA2       RLGIGFVPIRKAQTIGVDYEYGTNRLE-----------IHNDALQAGDRVVVVDDLLATGGTVVAACDLL
APT_HALMA       MTDIPLVVVRKRQ-YGLDGEVSLSQVTGYSESEMYVNDVYE-----GDQVLVLDDVLSXXXXXXXXXXXX
APT_DESAD       KLDIGFVPIRKPGKLPYETISVSYDLEYGTDNLSMHVDAVAK----DENVLLIDDVLATGGTAEGMVKLV
APT_METTH       KTGIPFVVVRK-RRYGLPGEVAVHQMTGYSEGELY-----INGVDSGDRVVVIDDVVSTGGTLLAVLEAL
APT_STRAW       QAGVGFIPVRKAGK--LPGATLSQSYD-LEYGSA-EIEVHAEDLVAGDRVMVVDDVLATGGTAEASLQLI
APT_SHEPA       ELGIGFVPVRKPGKLPRE-----TISESYELEYGHDVLIHVDAINADDKVLVIDDLLATGGTIEATVKLI
APT_TREDE       KMGIPLILIRKKGK--LPGETYSASYD-LEYGQA-SVEVHKTDVVKGQKVLLLDDLIATGGTLNAARSIL
APT_SHEHH       ELGIGFVPVRKPGKLPRE-----TISESYELEYGHDVLIHVDAINAEDKVLVIDDLLATGGTIEATVKLI
APT_BACHD       AIGKGFVPVRKAGKLPRE-------VISVDYGLEYGLTIHRDAIQKGQRVLIADDLLATGGTIEATVQMV
APT_NITOC       ELGVGFIPLRKSRSISYQLEYGSASLEAHTDS-----------LGPGDNVLLVDDLLATGGTAKASCELV
APT_MARMS       ELQKPLILVRKKGK--LPGKTISQKY-ALEYGEA-ELEIQEGAVKAGDEVLLFDDLIATGGTLLAAIELL
APT_NITEU       ALSAGFVPVRKAETIGCDYQL--------EYG--YDKVIHVDAIDKGDRVLLIDDLIATGGTMEAAIKLV
APT_CLOPS       ALGVGFIPVRKPGKLPGD----TVRVEYDLEYGKDALEIHKDAIKPGMRVAIVDDLLATGGTIAAVAKLV
APT_CLOPE       ALGVGFIPVRKPGKLPGD----TVRVEYDLEYGKDALEIHKDAIKPGMRVAIVDDLLATGGTIAAVAKLV
APT_CLOP1       ALGVGFIPVRKPGKLPGD----TVRVEYDLEYGKDALEIHKDAIKPGMRVAIVDDLLATGGTIAAVAKLV
APT_ACTSZ       ALGLPFILVRKPGKLPREVISQSYQLE---YGED-KLEIHADAIQKGDNVLVIDDLLATGGTVEACIKLV
APT_LACBA       EMGIGFAPARKEGKLPRETVKASYDLE-YGQSALY---LHKDAIKPGQKVLVTDDLLATGGTIGATIQLV
APT_SHELP       ELGVGFVPVRKPGKLPRE-----TISESYELEYGHDMLIHTDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_DEBHA       ALGAGFVPVRKAGK--LPGPVFTAEFQKEYGSDKFQI--QKDVIEEGAKVLIVDDILATGGSASSAGELV
APT_PASMU       ALNVPFVLVRKPGKLPRETISQTYQLE---YGQ--DTLIHTDAIHAQDKVLIIDDLLATGGTVEATVKLV
APT_KLEP7       ALGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIDATVKLI
APT_BACSU       ALGVGFAPVRK------EGKL-PREVIKVDYGLEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACA2       ALGVGFAPVRK------EGKL-PREVIKVDYGLEYDVLIHKDAILPGQRVLITDDLLATGGTIEATIKLV
APT_LEUMM       KGGK---LPREAVSASYTLE----------YGGVNELEIHKDAIKPGQRVLIVDDLLATGGTINATREII
APT_LACPL       ELGVGFAPARKKGKLPRETVKATYDLE-YGQSALY---LHKDAIKPGQNVLVTDDLLATGGTISATIQMV
APT_HALWD       MTDIPLVVIRKRQ-YGLEGEVSLSQQTGYAENEMYINDVRD-----GERVLVLDDVLSTGGTMRAVLDAL
APT_HALSA       MTDIPIVVIRKRE-YGLPGEVALSQETGYSENEMYINDVHE-----GDRVLVLDDVLSTGGTLRAITDAL
APT_HALS3       MTDIPIVVIRKRE-YGLPGEVALSQETGYSENEMYINDVHE-----GDRVLVLDDVLSTGGTLRAITDAL
APT_ACTPJ       ALGVPFVLVRKPKKLP---RAVISQSYALEYGE--DTLIHLDSVKENDNVLMVDDLLATGGTIDATAKLI
APT_ACTP7       ALGVPFVLVRKPKKLP---RAVISQSYALEYGE--DTLIHLDSVKENDNVLMVDDLLATGGTIDATAKLI
APT_ACTP2       ALGVPFVLVRKPKKLP---RAVISQSYALEYGE--DTLIHLDSVKENDNVLMVDDLLATGGTIDATAKLI
APT_THEFY       RLGAGFVPLRKAGKLPAE-----TLAESYDYGTA-TVEMHADAVPPGSRVLIVDDVLATGGTGRAAVDLI
APT_MAGSA       KLGCGFVMLRKKGK--LPGE--TIRHDYALEYGTDTIEIQKGAIEEGKRVVILDDLLATGGTMAAGVELL
APT_STACT       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_SHEWM       ELGVGFVPVRKPGKLPRE-----TISESYELEYGHDVLLHTDAINENDKVLVVDDLLATGGTIEATVKLI
APT_PROM4       KLSKPMIVARKPGK--LPGELITHSYE-LEYGQ-NSLSIQKKAIENYQSFVIVDDLLATGGTAMCVSEML
APT_NITEC       ALGAGFVPIRKAETISCDYQL--------EYG--YDKIIHADAIDKDDRVLMIDDLIATGGTMEAAIKLV
APT_STAES       SMGIGFAPVRKEGKLPREVIRYEYNLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAEQ       SMGIGFAPVRKEGKLPREVIRYEYNLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_SHEFN       ELGVGFVPVRKPG-----------KLPRKTISQTYDLEYGKDTLNANDKVLVIDDLLATGGTIEATVKLI
APT_KLEP3       ALGVGFVPVRKPRKLPRETIAESYELEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIDATVKLI
APT_GEOSM       KLGAGIVLVRKPG-----------KLPSQTRSKTYDLEYGTDTLNKGDRVLIADDLLATGGTMAAVVDLI
APT_GEOBB       KLGAGIVLVRKPG-----------KLPSKTRSKTYDLEYGTDTLNKGDRVLIADDLLATGGTMAAVVDLI
APT_ERWCT       ALGVGFVPVRKPGKLPRP-----TISESYELEYGSDTLIHADAISAGDNVLVIDDLLATGGTLEATVKLI
APT_BACWK       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACHK       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACCZ       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACCR       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACCQ       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACC7       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACC4       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACC2       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACC1       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACC0       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACAN       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACAH       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACAC       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACAA       -YALEVGFAPVRKLGKLPREVITV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_SODGM       ALGLGFVPVRKPGKLPRETISENYVLEYGTDG----LEIHKDAIVPGDKVLVVDDLLATGGTICATVKLI
APT_RHORT       KLGLGFVMVRKKGK--LPGA--TVRHEYALEYGTDTVEVQEGAVLPGQRVVILDDLLATGGTLNAASELL
APT_PHOLL       RLGVGFIPVRKAGKLPRETLSETYNLEYGTD----TLEMHKDSVRENDKVLVIDDLLATGGTVEATVRLI
APT_MANSM       ALGLPFVLVRKPRKLPRE-----TISQSYQLEYGEDTLMHVDSVKAGDNVLIIDDLLATGGTVDATIKLI
APT_CHLAA       RLGVGLVPIRKPGKLPAATYQIEYQLEYGTNR----LEIHRDAFQPGARVLVIDDLLATGGTIAAACDLI
APT_BACLD       ALGVGFAPVRK------EGKL-PREVIKVDYGLEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_BACCN       -YALEVGFAPVRKLGKLPREIIKV-----DYGKEYDVLIHKDAIKPGQRVLITDDLLATGGTIEATIQLV
APT_SALG2       GLGVGFVPVRKPRKLPRETIAETYELEYSTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_PECCP       ALGVGFVPVRKPGKLPRP-----TISESYELEYGSDTLIHSDAISAGDNVLVIDDLLATGGTLEATVKLI
APT_LEPBL       QLGVGFIPIRKKGKLPAE-----TVSEEYDLEYGKDVIIHKDAVQPGDKILLMDDLIATGGTMIAAVKLL
APT_LEPBJ       QLGVGFIPIRKKGKLPAE-----TVSEEYDLEYGKDVIIHKDAVQPGDKILLMDDLIATGGTMIAAVKLL
APT_LACS1       ELGVGFAPARKKGKLPRE----TVKADYSLEYGTASLYMHKDAVKPGQKVLVTDDLLATGGTIGATIDLV
APT_HAEIE       ALGLPFELVRKPKKLPRE-----TISQSYQLEYGQDTLMHVDAISEGDNVLIIDDLLATGGTVEATVKLV
APT_BACP2       ALGVGFAPVRK------EGKL-PREVVKVEYGLEYDVLIHKDAIRPGQRVLITDDLLATGGTIEASIKLV
APT_SALTY       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALTI       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALSV       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALPK       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALPC       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALPB       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALPA       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALNS       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALEP       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALDC       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALCH       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_SALA4       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_RHOOB       ELGSGVVAVRKSGKLP---PPVLSQSYTLEYGTATLEIPAGSIGLDGRSVLVVDDVLATGGTLDATARLV
APT_PEDPA       EMGIGFAPARKKGKLPRETVKATYGLE---YGKS-ELYLQKDAIKPGQKVLITDDLLATGGTIAATIELV
APT_STRU0       ELGIG--FAPVRKPGKLPREVVSADYEK-EYG-LDTLTMHSDAIKPGQRVLIVDDLLATGGTVKATIEMV
APT_SALHS       GLGVGFVPVRKPRKLPRETIAETYALEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_MARMM       QLSVGFVPVRKRGKLP-----WRTLREDYELEYGQDTIIHVDAIAEGDRVLLVDDLIATGGTAEASIKLL
APT_LACLA       -FALGVGFAPVRKPGKLPREVIEATYEK-EYG-TDTLTMHSDSIKPGQRVLIVDDLLATGGTIAATIELV
APT_IDILO       AMGCGVTLLRKPGK--LPGKVTRQNYE-LEYGSD-ELQMHENALTENDRVLIVDDLLATGGTVVAASQLI
APT1_YEAST      ALGVGFVPVRKAGK--LPGECFKATYEKEYGSDLFEI--QKNAIPAGSNVIIVDDIIXXXXXXXXXXELV
PYRE_PELTS      ALGVRGLFAERE-----NGVMTLRRGFSIEPG---------------ERVLVVEDVITTGGSVREVMEAV
APT_TREPS       RMGIPLILVRKAG--KLPGDTYSCSY-SLEYGKA-TVEVHKSDVVAGARVLLTDDLIATGGTLN------
APT_TREPA       RMGIPLILVRKAG--KLPGDTYSCSY-SLEYGKA-TVEVHKSDVVAGARVLLTDDLIATGGTLN------
APT_STRSY       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRS2       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRGC       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STAAW       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAU       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAT       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAS       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAR       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAN       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAM       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAE       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAC       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAAB       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAA9       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAA8       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAA3       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAA2       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_STAA1       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_SALAR       GLGVGFVPVRKPRKLPRETIAETYELEYGTD----QLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLI
APT_OCEIH       -YALEVGFAPVRKEGKLPREVIKV-----DYGLEYGLTIHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_METKA       MLDRPLVIVRKRE-YGLDGEVEITQEKGYGVEKLYLNGVSE-----GDRVVVVDDVISTGGTLVGLI---
APT_LACLM       -FALGVGFAPVRKPGKLPREVIEATYEK-EYG-TDTLTMHSDSIKPGQRVLIVDDLLATGGTIAATIELV
APT_EXIS2       AMEIGFVPVRKEGKLPRE----TVRVE---YGLEYDVLMHHDAIQPGQRVVILDDLLATGGTIEATIKMI
APT_STRSV       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_MACCJ       -YAMNIGFAPVRKKGKLPREVISYEYELEYGTNV--LTMHKDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_GEOSW       ALGVGFAPVRKEGKLPRE----VVRVE---YGLEYDVLMHKDAIKPGQRVLITDDLLATGGTIRATIQLV
APT_CLOK5       TLGAGFVPVRKQGKLPYDTLSIKYDLEYGS-----DVLIHKDAINKGDRVALVDDLLATGGTTSSVVKLI
APT_CLOK1       TLGAGFVPVRKQGKLPYDTLSIKYDLEYGS-----DVLIHKDAINKGDRVALVDDLLATGGTTSSVVKLI
APT_CLOB8       ALGVGFIPVRKPGK--LPGETI-----SVNYGLEYQLQLHKDAIKPGQRVAVVDDLLATGGTVEGVAKLI
PYRE_CHLPD      QLGVKTIFAERK-----DGRMTIRRGFSVAPG---------------EKVLVIEDVITTGGSVQEVIELL
APT_STRPZ       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRPM       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRPG       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRPF       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRPD       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRPC       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRPB       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRP8       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRP6       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRP3       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRP1       ELGIGFAPVRKPGKLPRD-------VVSADYEKEYGLDTLTMHADAGQRVLIVDDLLATGGTVKATIEMI
APT_STRA1       ALGIG--FAPVRKPGKLPREVISANYEK-EYG-LDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STAS1       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTNV----LTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_SHESH       ELGLGFVPVRKPGKLPRE-----TISESYELEYGHDVLIHVDAINENDKVLVIDDLLATGGTIEATVKLI
APT_RUBXD       RSRKGLVLARKPGKLPREVISVSYELEYGTDS----LEVHADAIPPGTRVLVADDLLATGGTARAMCELV
APT_LEUCK       KGGLPRAAVSAAYSLEYGGENVLE--------------IHQDAIKPGQRVLIVDDLLATGGTINATREII
APT_LACLS       -FALGVGFAPVRKPGKLPREVIEATYEK-EYG-TDTLTMHSDSIKPGQRVLIVDDLLATGGTIAATIELV
APT_HAEIN       ALGLPFELVRKPKKLPRE-----TISQSYQLEYGQDTLMHVDAISEGDNVLIIDDLLATGGTVEATVKLV
APT_HAEIG       ALGLPFELVRKPKKLPRE-----TISQSYQLEYGQDTLMHVDAISEGDNVLIIDDLLATGGTVEATVKLV
APT_HAEI8       ALGLPFELVRKPKKLPRE-----TISQSYQLEYGQDTLMHVDAISEGDNVLIIDDLLATGGTVEATVKLV
APT_ENTS8       ALGVGFVPVRKPRKLPRETIAESYELEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ENT38       EMGVGFVPVRKPRKLPRETIAESYELEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ALKMQ       KIGAGFVPIRKPGKLPGETISYEYELEYGTDS----LEIHTDAIQPGQRVAILDDLLATGGTVVATAKLI
PYRE_YARLI      --GIPLAAVTAAKIAELGGEKYATKEYAFNRKEAKDHGEGGNIVGASKKVLIIDDVITAGTAIKEAFSII
APT_VIBVY       QLGVGFVPVRKAQSYELEYGVDTLEIHT-------DAIVE------GDKVLVVDDLLATGGTIEATTKLI
APT_VIBVU       QLGVGFVPVRKAQSYELEYGVDTLEIHT-------DAIVE------GDKVLVVDDLLATGGTIEATTKLI
APT_STRZT       ELGIG--FAPVRKPGKLPREVIFADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_HAES2       ALNVPFILVRKPGKLPRETIAQSYQLE---YGQTLEMHVSS--IQAGDNVLVIDDLLATGGTIEATVKLV
APT_HAES1       ALNVPFILVRKPGKLPRETIAQSYQLE---YGQTLEMHVSS--IQAGDNVLVIDDLLATGGTIEATVKLV
APT_GEOTN       ALGVGFAPVRKEGKLPRE----VVRVE---YGLEYDVLMHKDAIKPGQRVLITDDLLATGGTMRATIDLV
APT_GEOKA       ALGVGFAPVRKEGKLPRE----VVRVE---YGLEYDVLMHKDAIKPGQRVLITDDLLATGGTMRATIDLV
APT_VIBHB       ELGVGFVPVRKAQSYELEYGVDTLEIHT-------DAIVE------GDKVLVVDDLLATGGTIEATTKLI
APT_STRZP       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRR6       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRPN       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRPJ       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRPI       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRP7       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRP2       ELGIG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRMU       ELGVG--FAPVRKPGKLPREVIEAHYEK-EYG-IDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRA5       ALGIG--FAPVRKPGKLPREVISADYEK-EYG-LDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRA3       ALGIG--FAPVRKPGKLPREVISADYEK-EYG-LDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STAHJ       SMGIGFAPVRKEGKLPREVIRYEYDLEYGTN----ILTMHNDAIKPGQRVLITDDLLATGGTIEAAIKLV
APT_SHIFL       GLGVGFVPVRKPGKLNYDLEYGTDQLE-----------IHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_SHIF8       GLGVGFVPVRKPGKLNYDLEYGTDQLE-----------IHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_FUSNN       ALGVGFVPVRKPGKLPREVIEYAYDLEYGSN----KLCLHKDSIKPGQKVLVVDDLLATGGTVEATIKLV
APT_CORJK       ------------------------------------------------NVFLIDDVLATGGTLSASRELL
APT_ASHGO       AIGAGFVPVRKAGK--LPGQVVKTTYVKEYEEDVFEMQVDSIPVGAT--VVVVDDILATGGSAGAAGDLI
PYRE_PROA2      QLGVKTIFAERK-----DGAMSLRRGFSIEPG---------------EKILVIEDVITTGGSVAEVIEIV
APT_VIBPA       ELGVGFVPVRKAQSYELEYGIDTLEIHT-------DAIVE------GDKVLVVDDLLATGGTIEATTKLI
APT_STRS7       ELGIG--FAPVRKPGKLPREVISASYEK-EYG-LDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIDLV
APT_STREM       ELGIG--FAPVRKPGKLPREVISASYEK-EYG-LDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIDLV
APT_STRE4       ELGIG--FAPVRKPGKLPREVISASYEK-EYG-LDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIDLV
APT_SHISS       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_SHIDS       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_SHIBS       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_SHIB3       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_SHEDO       ELGIGFVPVRKAQSYELEYGMDTLEIH-------VDAI------KPEDKVLVVDDLLATGGTIEATVKLI
APT_KOSOT       ELEVPIKLPYKTVSVEYSLEYGTATLEMHTDA-----------IKEGDKVLIVDDVLATGGTMKAIAEMV
APT_ESCF3       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_EDWI9       ALGVGFVPVRKPGKLPR-----ATLAESYALEYGTDTLIHQDAIDANDRVLMVDDLLATGGTIEATTRLI
APT_ECOUT       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOSM       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOSE       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOLU       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOLI       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOLC       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOL6       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOL5       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOK1       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOHS       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECODH       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECOBW       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO8A       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO81       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO7I       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO55       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO45       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO27       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO24       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_CITK8       GLGVGFVPVRKPRKLPRETIAESYELEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_AERHH       AMGLGFVPVRKPGKLPVIEESYALEYGTDTLQLHTDAIVP------GDKVLVVDDLLATGGTVDATVKLI
PYRE_THETH      ALGARALFAEK-------------------DGRGGMLIRKGLTVNPGDRFLAVEDVVTTGESVRKAIRAA
PYRE_THET8      ALGARALFAEK-------------------DGRGGMLIRKGLTVNPGDRFLAVEDVVTTGESVRKAIRAA
PYRE_THET2      ALGARALFAEK-------------------DGRGGMLIRKGLTVNPGDRFLAVEDVVTTGESVRKAIRAA
PYRE_SERP5      ------------------------RKEAKTHGEGGTLVGSP----LQGRVMLVDDVITAGTAIRESMEII
APT_YERE8       SLGVGFVPVRKPGKLSYELEYGTDKLEIHTDS-----------IKPGDKVLVIDDLLATGGTIEATVKLI
APT_STRTD       ELGIGFAPVRKPGKL-------PRKVISVDYEKEYGVCMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRT2       ELGIGFAPVRKPGKL-------PRKVISVDYEKEYGVCMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_STRT1       ELGIGFAPVRKPGKL-------PRKVISVDYEKEYGVCMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_PROM0       KLSKPLILARKPG--KLPGKLSTYKYD-LEYGSNSLSLQDDSIRNLDNFV-IVDDLLATGGTVNSVSKIL
APT_LACC3       KLGIGFAPARKKGKLPRPTVKASYDLE-YGEATLY---LHKDAIKPGQRVLVCDDLLATGGTIAATIRLV
APT_ENTFA       ELGVGFAPVRKKGKLPRETIEVTYDLEYGSD----TLTLHKDAITPGQRVLICDDLLATGGTIKATIELV
APT_CLOBB       -FGVPVAYALGAGFVKLPGETISVNYD-LEYGSD-SLQIHKDSIKKGQRVAIVDDLLATGGTVEGVAKLV
APT_CLOBA       -FGVPVAYALGAGFVKLPGETISVNYD-LEYGSD-SLQIHKDSIKKGQRVAIVDDLLATGGTVEGVAKLV
PUR1_SHIFL      ILGKP--YRQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMA
PUR1_ECOLI      ILGKP--YRQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMA
APT_SOLUE       ALGAGFVPVRKPKKLPAECVRITYDLEYGT-----DTLEMHKDAIGNGHVLIVDDXXXXXXXXXXXXRMV
APT_PELCD       KLGTGITLVRKPGKLPYKTIQKTYQLEYGTD----TLEIHSDAFKPGDRVVVADDLLATGGTVAAVAELV
APT1_WHEAT      AIGAKFVPIRKPKK--LPGEVISEEY-SLEYG-TDKIEMHVGAVQPNDRVLIVDDLIATGGTLCAAAKLI
PYRE_YERPY      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERPS      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERPP      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERPN      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERPG      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERPE      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERPB      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERPA      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
PYRE_YERP3      ------------------------RKEAKTHGEGGNLVGSP----LQGRVMLVDDVITAGTAIRESMEII
APT_VIBCM       ELGVGFVPVRKPGKLPRQTVAQSYELEYGTDTLEIHVDAIKP----GDKVLVVDDLLATGGTIEATTKLI
APT_VIBCH       ELGVGFVPVRKPGKLPRQTVAQSYELEYGTDTLEIHVDAIKP----GDKVLVVDDLLATGGTIEATTKLI
APT_VIBC3       ELGVGFVPVRKPGKLPRQTVAQSYELEYGTDTLEIHVDAIKP----GDKVLVVDDLLATGGTIEATTKLI
APT_STRP4       ELGXG--FAPVRKPGKLPREVISADYEK-EYG-VDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMI
APT_SHESR       ELGIGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAITANDKVLVVDDLLATGGTIEATVKLI
APT_SHEAM       ELGVGFVPVRKPGKLPRE-----TISESYELEYGHDTLIHVDAIKAGDKVLVIDDLLATGGTIEATVKLI
APT_RHOSR       ELGSGVVAVRKSGKLP---PPVLSQSYTLEYGTATLEIPAGSIGLDGRSVLVVDDVLATGGTLDATARLV
APT_RENSM       XTGTGVITVRKAGKLP---RAVYTEHYSLEYGTAA-LELHRDDLPAGSRVLILDDVLATGGTLAATSKLF
APT_COPPD       RLGVGFIPIRKPGKLPFEVVEKEFELE---YGK--DVLIHKDAAGPGDSILIVDDVLATGGTAQAAADLV
APT_ACHLI       NLGVGFAPVRKPGKLPRASVTVSYDLEYGSNS----LSLHEDAVKPGQRVVIIDDLLATGGTMQATVELV
PYRE_THEMA      YLKARSLFAERENGVMKLRRGF--------------------FVKPGEKVAVVEDVVTTGGSVKEVIELL
PYRE_ACTSZ      --GIPIGTTVSVALFNLDKPVCFNRKEAKDHGEGGNLIGSP----LQGNVLLVDDVITAGTAIREAMDII
APT_YERPY       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_YERPS       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_YERPB       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_YERP3       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_VIBF1       ELGVGFVPVRKPGKLTYDLEYGTDTLEIHT-----DAIVE------GDKVLVVDDLLATGGTIEATVKLI
APT_SERP5       ALGVGFVPVRKPGKLSYELEYGTDKLEIHTDA-----------ISAGDKVLVVDDLLATGGTIEATAKLI
APT_PSEU2       QLNKPLVLFRKQGKLPADSEAYQTE-----YGEAY-LEVHADSLCEGDSVVMFDDLIATGGTLIAAANLI
APT_PROMP       QVSKPMIFARKPG--KLPGELIKKKY-TLEYGE-NSLSIQKKSLNNFYSFAIIDDLLATGGTVNCVSNIL
APT_NITMS       RYNKGMMMIRKAG--KLPGK--TTKI-SYTIEYGKDTIIQKDIIEEGQRVLICDDXXXXXXXXXXXXXXI
APT_CANAL       ALNAGFVPVRKPGK--LPGPTFKVEFQKEYGSDEFEI--QQDVIPKGAKVLIVDDILATGGSAFGAGELA
APT_AERS4       AMGLGFVPVRKPGKLPVIEESYALEYGTDTLQLHTDAIVP------GDKVLVVDDLLATGGTVDATVKLI
PYRE_YERE8      --GIPIATTTAAEHHNRDLPYCFNRKEAKDHGEGGSLVGSP----LEGRVMLVDDVITAGTAIRESMEII
PYRE_RHIME      RLGLPMIYVRKAPK---------------GHGRNAQI---EGYMPEGARVLVIEDLTTAGGSMFKFIDAI
APT_YERPP       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_YERPN       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_YERPG       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_YERPE       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_YERPA       ALGVGFVPVRKPGKLPRE-----TISESYELEYGTDTLIHTDSIQPGDKVLVVDDLLATGGTIEATVKLI
APT_UREPA       KLNKPFILVRKPNKLPNDVYSAEYTLE-YGSSRVE---MHKDALKPNQRVLIVDDLLATGGTVAAIENLV
APT_UREP2       KLNKPFILVRKPNKLPNDVYSAEYTLE-YGSSRVE---MHKDALKPNQRVLIVDDLLATGGTVAAIENLV
APT_SYNPW       -----------------------------------------------DHVLLVDDLLATGGTASASAELV
APT_SHESM       ELGIGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAITANDKVLVVDDLLATGGTIEATVKLI
APT_SHESA       ELGIGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAITANDKVLVVDDLLATGGTIEATVKLI
APT_SHEPW       ELGIGFVPVRKPGKLPRE-----TISESYELEYGHDVLIHVDAITKEDKVLVVDDLLATGGTIEATVKLI
APT_EXISA       ALELGFVPVRKEGKLPRE----TVRV---SYGLEYDILMHKDSIQPGQQVVILDDLLATGGTIEATIKMI
APT_ECO5E       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_ECO57       GLGVGFVPVRKPGKLPRETISETYDLEYGTD----QLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
APT_CARHZ       KLGLGFVPVRKSISVSYDLEYGNNTLEIHTDA-----------LKPGDRVVIVDDVLATGGTMKATVELC
APT_ACIC1       HLGAGFVPMRK------KGKLPYRTLET-SYALEYGTATIEVHVDAGDRVLVVDDVXXXXXXXXXXXELI
PYRE_VESOH      ----------------------------------------------EGNILIIDDVITAGTAIHEAVDII
APT_SHESW       ELGIGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAISANDKVLVVDDLLATGGTIEATVKLI
APT_SHEPC       ELGIGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAISANDKVLVVDDLLATGGTIEATVKLI
APT_SHEB9       ELGVGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAINPNDKVLVVDDLLATGGTIEATVKLI
APT_SHEB8       ELGVGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAINPNDKVLVVDDLLATGGTIEATVKLI
APT_SHEB5       ELGVGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAINPNDKVLVVDDLLATGGTIEATVKLI
APT_SHEB2       ELGVGFVPVRKPGKLPR-----ATISQSYELEYGHDSLIHTDAINPNDKVLVVDDLLATGGTIEATVKLI
APT_SACEN       AHGTGVVGLRKPGKLPEVAHRVDYRLE---YGSA-SLELPAGTLRAGQRVLVVDDVLATGGTLNAACELV
APT_PROMA       KLSKPLILARKAG--KLPGPILSSTY-NLEYGE-NSLSIQKESLNEFKNFAIIDDVLATGGTINCVKSLL
APT_MYCS5       HLKKPFVMVRKPKK--MPGPSYSVSYELEYGHNVLEL--QEDLIKENASVSIVDDILATGGTLNAMIELL
APT_CLOCE       -----------------------------------------------EKVLIVDDLLATGGTTEANIKLV
APT_BLOPB       ILKLGFIPARKSGRLPRD-TIREPYILEYDNGFLE---IHTDSITPGDQVLIIDDLLATGGTIAAAVKLI
APT_ACIC5       RLNAGFVPVRKPRKLPARTVRVTYDLEYGSD----TLEIHEDAIEPGQRIVLVDDLLATGGTMEATVKLV
UPP_COREF       ---------------------------------------------SDQPVFLVDPMLATGGSLLHAIRLL
PYRE_XANCP      GRDLPLAFNRKEAKDHGEGG---TLIGAPLQGR---------------KVLIVDDVITAGTAIREALGII
PYRE_XANCB      GRDLPLAFNRKEAKDHGEGG---TLIGAPLQGR---------------KVLIVDDVITAGTAIREALGII
PYRE_XANC8      GRDLPLAFNRKEAKDHGEGG---TLIGAPLQGR---------------KVLIVDDVITAGTAIREALGII
PYRE_SINMW      RLGLPMIYVRKAPK---------------GHGRNAQI---EGNMPEGARVLVIEDLTTAGGSMFKFIDAI
PYRE_BACHD      -------------SDRLQAPMVYVRSKSKGHGKQNQI---EGKLSSKDRVVIIEDLISTGGSVIQAADAL
APT_SYMTH       -------------------------------------------------VLVVDDLLATGGTIRATIDLV
APT_PSESM       QLNKPLVLFRKQGKLPADSEAYQTE-----YGEAY-LEVHADSLCEGNSVIMFDDLIATGGTLIAAANLI
APT_PSE14       QLNKPLVLFRKQGKLPADSEAYQTE-----YGEAY-LEVHADSLCEGDSVIMFDDLIATGGTLIAAANLI
APT_PROAC       SLGAGFVPVRKPGKLPGDSQSFVLEYGSAT------LTVHQDAVQPGSKVLIVDDVLATAGTVRATASLV
APT_MESFL       KSHTRFVLVRKPGKLPREVIDIEYTLEYGTNHQQ----MHKGDIKPGDKVVIIDDVLATGGTIEAIVKLV
APT_BIFLO       HLGKGFIAVRKAGKLPPE-----------TIGESYDVEIETDAVQAGKRVLIVDDLIATGGTAKAATDLI
PYRE_THETN      QIGVRALFAEREDNVMKLRRGFE--------------------ISKGERVLVVEDVVTTGGSVKEVIELV
PYRE_AERS4      --GIPIASATAVQLVDVDVPWCFNRKEAKDHGEGGNLVGSP----LKGRIMLVDDVITAGTAIRESMDLI
APT_LISW6       ALGIGFAPVRKPGKLPRE----TIEMEYDLEYGTNKLSMHSDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_LISMO       ALGIGFAPVRKPGKLPRE----TIEMEYDLEYGTNKLSMHSDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_LISMH       ALGIGFAPVRKPGKLPRE----TIEMEYDLEYGTNKLSMHSDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_LISMF       ALGIGFAPVRKPGKLPRE----TIEMEYDLEYGTNKLSMHSDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_LISMC       ALGIGFAPVRKPGKLPRE----TIEMEYDLEYGTNKLSMHSDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_LISIN       ALGIGFAPVRKPGKLPRE----TIEMEYDLEYGTNKLSMHSDAIKPGQRVLITDDLLATGGTIEATIKLV
APT_LACSS       KLGVGFAPARKKGKLPRETVSASYGLE---YGKS-TLYMHKDAVKPGQKVLVTDDLLATGGTIAATIKMV
APT_GEOUR       KLGAGIVLVRKPGKLPSETFKKSYELEYGTD----TLEIHTDAIEKGERVLIADDLLATGGTMAAVVDMV
APT_GEOLS       RLGAGVVLVRKPG-----------KLPSETFSKTYDLEIHKDAIKPGEKILIADDLLATGGTMAAVVDMV
APT_COLP3       -------------------------------------------LTPEDNVLIIDDLLATGGTIEATTKLI
APT_ALISL       ELGVGFVPVRKPGKLTYDLEYGTDTLEIHT-----DAIVE------GDKVLVVDDLLATGGTIEATVKLI
PYRE_THESQ      YLKARSLFAERENGVMKLRRGF--------------------FVRPGEKAAVVEDVVTTGGSVKEVIELL
PYRE_THEP1      YLKARSLFAERENGVMKLRRGF--------------------FVRPGEKAAVVEDVVTTGGSVKEVIELL
PYRE_THENN      YLKARSLFAERENGVMKLRRGF--------------------FVRPGEKAAVVEDVVTTGGSVKEVIELL
APT_PSEHT       ALGIPFIPVRKPGKLEVVRQDYLLEYGEDTLELHVDAIV------PGDKVLLVDDLLATGGTIEATIKLV
APT_PROMM       -------------------------------------------LQGHPRVLLVDDLLATGGTARATVELI
APT_PROM3       -------------------------------------------LQGHPRVLMVDDLLATGGTAKATVELI
APT_GEOSF       KLGAGIVLVRKPGKLPSETFKKTYDLEYGTDTLEMHTDAIKK----GERVLIADDLLATGGTMSAVVDMV
APT_CLONN       -FGTPVAYALGAAFVPVKGKLPCETISSLEYGS--DVLIHKDAIKKGQKVAIVDDLLATGGTMNSVIEMI
APT_ANAVT       --------------------------------------VHRDALHPDSRVLIVDDLIATGGTASATAKLV
APT_ANASP       --------------------------------------VHRDALHPDSRVLIVDDLIATGGTASATAKLV
APT_ANADF       -------------------------------------------VKAGERVLVVDDVLATGGTADAVGRLV
PYRE_RHISN      RLGLPMIYVRKAPK---------------GHGRNAQI---EGHMPEGARVLVIEDLTTAGGSMFKFIDAI
APT_LACJO       ELGVGFVPARKPHKLPREVESASYDLEYGSNV----LEMHKDAIKPGQKVVICDDLMATAGTLHATKELI
APT_BRASO       QLSAGFVPIRKKGKLPHKTVSMSYALEYGTD----EMEMHVDAVQPGERVILVDDLIATGGTAEGAVKLL


                         +         .         .         .         .         *         .:210
query           GEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERMDPETGEIAFR
XPT_CLOPH       ISSGASVEGIGIVIEKGFQSGGEIIREMGIHLESLAIVDSMNAEDGTVVFR
XPT_BIFLO       EAAGATVEGIGIAVEKGFQGGGDALRAEGYDVDSLAIVESMNPETGEITFR
XPT_BIFLD       EAAGATVEGIGIAVEKGFQGGGDALRAEGYDVDSLAIVESMNPETGEITFR
XPT_BIFAA       HEAGATVEGIGIAVEKGFQGGGDQLREEGYDVDSLAIVESMDPENGTIEFR
XPT_BIFLI       EAAGATVEGIGIAVEKGFQGGGDTLRAEGYDVDSLAIVESMNPETGEITFR
XPT_BIFA0       XXXXXXXXXXXXXXXKGFQGGGDALREAGYDLDSLAIVESMDAETGAIEFR
XPT_CLOCE       EQSGAKLGGIGIAVEKGFQDGGKLLREKGFDVKSLAIISSM--ENGRLSF-
XPT_CLONN       REANGEVQGVGIVIEKGFQNGRKTIENKGVTVESLAIVESM--KNGKVIFK
XPT2_CLOBL      KQGGAELAGVGIAIEKGFQKGRKELEKVGAKVESLAILDKIE---------
XPT2_CLOBH      KQGGAELIGVGIAIEKGFQKGRKELEKVGAKVESLAILDKIE---------
XPT2_CLOB1      KQGGAELIGVGIAIEKGFQKGRKELEKVGAKVESLAILDKIE---------
XPT_LACSS       DQAGAQLEGVGIVIEKTFQKGRELLDQRGIHVESLARIAAF--EQGEVVF-
XPT_ALKMQ       VQANANLVGAGIVIEKGFQGGGKRLRAENMRIESLAIIDEMNEST------
XPT_CLOD6       EQAEANLVGVGIVIEKGFQAGGALLKANDVRLESLAVVESID--NGTVKFR
XPT_PSE14       KQAGATVAGLGIVIEKSFQGGRAELDAQGYRVESLARVESL----------
XPT_FINM2       SQANATVEGIGILIEKVFQKGGENLRRQGYTIESLARIK------------
XPT_LACCB       AQAGATLSGVGIVIEKTFQKGRKLLDEKHVRVESLARINAF--ENGQVIF-
XPT_LACC3       AQAGATLSGVGIVIEKTFQKGRKLLDEKHVRVESLARINAF--ENGQVIF-
XPT_BACSK       EEAGATVAGIGIVIEKSFQDGRALLEGKGYRIESLARISSLE---------
XPT_PSEU2       KQAGATVAGLGIVIEKSFQGGRAELDAQGYRVESLARVESL----------
XPT_PSEPK       KQAGATVAGLGIVIEKSFQGGRAELDSQGYRVESLARVKSL--EGGVVSF-
XPT_PSEPG       KQAGATVAGLGIVIEKSFQGGRAELDSQGYRVESLARVKSL--EGGVVSF-
XPT_PSEP1       KQAGATVAGLGIVIEKSFQGGRAELDSQGYRVESLARVKSL--EGGVVSF-
XPT_MOOTA       TQAGATLVGVGTVIEKVFQTGGEALRDQGIRVESL----------------
XPT_PSESM       KQAGATVAGLGIVIEKSFQGGRAELDAQGYRVESLARVESL----------
XPT_PSEE4       KQAGATVAGLGIVIEKSFQGGRAELDSQGYRVESLARVKSL--EGGVVTF-
XPT_CLOTE       EKSGAIVEGVGIVIEKEFQKGRKIILNKGIQLESLAIIKGF--EDNKVVFK
XPT_OCEIH       KQAKATVVGVGIVIEKGFQTGGKQLRDKGIRVESLAIVESLSDGT------
XPT_LARHH       RQAGAEPVGVGIVIEKGFQPGRSKIEAHGIRVESLAIIQSFD---------
XPT_ENTFA       QQAGAKVEGIGIVIEKSFQDGRQLLEDMGLNVVSLARIASLSEGT------
XPT_PSEAE       GQAGASIAGLGIVIEKSFQDGRALLESEGYRVESLARVKSL----------
XPT_PSEAB       GQAGASIAGLGIVIEKSFQDGRALLESEGYRVESLARVKSL----------
XPT_PSEA8       GQAGASIAGLGIVIEKSFQDGRALLESEGYRVESLARVKSL----------
XPT_LACS1       DAAGAEIKGVGIVIEKSFQEGAKIIHDRGVRLESLAVISSFD---------
XPT_PSEA7       GQAGASIAGLGIVIEKSFQDGRALLESEGYRVESLARVKSL----------
XPT_PSEU5       NQAGASIAGLGIVIEKSFQTGRKELEEAGYRVESLARV-------------
XPT_BACV8       EKAGAELSGMGFIIEKAFQHGGDYLRNAGIRVESLAIIESLD---------
XPT_ACIAD       HQANADIVGVGIVIEKSFQPGRDLLLEKGYRVESLARVASL--TNGQVTF-
XPT_ACIBT       HQANAEVVGVGIVIEKSFQPGRDLLLEKGYRVESLARVQSL----------
XPT_ACIBC       HQANAEVVGVGIVIEKSFQPGRDLLLEKGYRVESLARVQSL----------
XPT_ACIB5       HQANAEVVGVGIVIEKSFQPGRDLLLEKGYRVESLARVQSL----------
XPT_ACIB3       HQANAEVVGVGIVIEKSFQPGRDLLLEKGYRVESLARVQSL----------
XPT_BACCN       EQAGASVSGIGIVIEKAFQDGGKKLRERGVRVESLAEIASL--EDGTVTF-
XPT_LACBA       KTAQITVAGVGVVIEKRFQKGHQMVTDAGIQLEALASIASF--EAGQVIF-
XPT_STRPS       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_PSEPF       KQAGATVAGLGIVIEKSFQGGRAELDSQGYRVESLARVKSL----------
XPT_PSEF5       KQAGATVAGLGIVIEKSFQGGRAELDSQGYRVESLARVKSL----------
XPT_STRZT       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRSV       EQAGAQIEAVGIVIEKSFQDGRQLLETAGYRVLSLARIAGF--EKGQIVF-
XPT_PSEFS       KQAGATVAGLGIVIEKSFQGGRAELDAQGYRVESLARVKSL----------
XPT_STRZJ       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRR6       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRPJ       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRPI       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRP7       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRP4       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRP2       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_STRA5       GQAGAKVAGIGIVIEKSFQDGRDLLEKTGVPVTSLARIKAF--ENGRVVF-
XPT_STRA3       GQAGAKVAGIGIVIEKSFQDGRDLLEKTGVPVTSLARIKAF--ENGRVVF-
XPT_STRA1       GQAGAKVAGIGIVIEKSFQDGRDLLEKTGVPVTSLARIKAF--ENGRVVF-
XPT_STRZP       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDRF--ENGQVVFK
XPT_BACHD       EQAGAQVVGFGIVIEKSFQDGRKKLTDKGYRVESLARIQ------------
XPT_STRPN       EQAGATVQAIGIVIEKSFQDGRDLLEKAGYPVLSLARLDCF--ENGQVVFK
XPT_STRGC       RQAGASVEAIGIVIEKSFQSGRKLLEDDGQRVVSLARIEKF--ENGKVVF-
XPT_STRU0       QQAGASVEGVGIVIEKSFQDGRQLLENMGVKVTSLARIKNF--ENGRLNF-
XPT_LACPL       DKAHVKIAGVGIVIEKVFQTGHQLIADRGVRLESLAQITSFD---------
XPT_BREBN       KDAGAHLVGVGAVIEKSFQEGRGLLEQAGVRIESLARIESMSPE-------
XPT1_CLOBL      QESGAKVAGMGIVIEKSFQPGRKMLEEKGYDVYSLARIAKL--EKGLIEF-
XPT_PSEMY       QQAGAQVAGIGIVIEKSFQEGRNLLESEGYRVESLARVAAL--ENGQVRF-
XPT_BACLD       EQAGAKVCGIGIVIEKSFQTGREELENLGIRVESLA---------------
XPT_STAAR       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT1_CLOPS      EQAGAELVGIGIVIEKGFQDGRKVLEDLGVRVESLAIIDKLE---------
XPT1_CLOPE      EQAGAELVGIGIVIEKGFQDGRKVLEDLGVRVESLAIIDKLE---------
XPT1_CLOP1      EQAGAELVGIGIVIEKGFQDGRKVLEDLGVRVESLAIIDKLE---------
XPT_BACA2       KQAGAAVCGIGIVIEKSFQPGRDELVKKGCRVESLARIQSL--EDGKVTF-
XPT_EXIS2       EQAGAEVAGFGIVIEKSFQPGRQKLLDAGFRVESLARIKKL--EAGEATF-
XPT_STAS1       KQAKATTVGIGIVVEKSFQPGRERLEEAGLTVSSLCKV-------------
XPT_STAES       KQANATTVGVGIVVEKSFQNGRQRLEDAGLYVSSLCKV-------------
XPT_STAEQ       KQANATTVGVGIVVEKSFQNGRQRLEDAGLYVSSLCKV-------------
XPT_STACT       HQAGAETVGVGIVVEKSFQQGRTRLEEAGLKVSSLCEV-------------
XPT_STAAW       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAAT       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAAS       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAAN       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAAM       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAAE       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAAC       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAAB       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAA9       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAA8       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAA3       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAA2       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_STAA1       QQANAKTAGIGIVVEKSFQNGHQRLEEAGLTVSSLCKVASLE---------
XPT_LISMO       EHAGAKVAGIGIVIEKSFQQGRELLNKTGIPVYSLA---------------
XPT_LISMF       EHAGAKVAGIGIVIEKSFQQGRELLNKTGIPVYSLA---------------
XPT1_CLOBH      KEAGAKVAGMGIVIEKSFQPGRKMLEDKGYDVYSLARIAKL----------
XPT1_CLOB1      KEAGAKVAGMGIVIEKSFQPGRKMLEDKGYDVYSLARIAKL----------
XPT_CLOB8       EEAGAKVAGIGIVIEKSFQKGAQMLKDKGYDVYSLARIAKL----------
XPT_LISMC       EHAGAKVAGIGIVIEKSFQQGRELLNKTGIPVYSLA---------------
XPT_MACCJ       QQAGATCVGVGIVVEKSFQSGKQRLLDAGLDVTSLCEIAALD---------
XPT_PEDPA       DAANIDVVGVGIVIEKTFQKGSQIIKDRDIQLESLARIKAL-TDDGQVEF-
XPT_LACLM       EQAKAEVVGLGMVIEKSFQDGRQKLLDQGMKLTSLARIEKF--EDGKVIF-
XPT_STAHJ       QQAKAKTVGIGIVVEKSFQDGRQRLEEAGLNVSSLCKV-------------
XPT_LACLS       EQAKAEVVGLGMVIEKSFQDGRQKLLDQGMKLTSIARIEKF--EDGKVIF-
XPT_EXISA       EAAGAEVSGVGIVIEKSFQLGRDKLIERGYRVESLARVAKLEKD-------
XPT_BACFR       KQSGANLVGMGFIIEKAFQNGRKTLEERGVRVESLAIIE------------
XPT_BACFN       KQSGANLVGMGFIIEKAFQNGRKTLEERGVRVESLAIIE------------
XPT_LACLA       EQAKAEVVGLGMVIEKSFQDGRQKLLDQGMKLTSLARIEKF--EDGKVIF-
XPT_BACSU       KQXXXXXXXXXXVIEKSFQPGRDELVKLGYRVESLARIQSL--EEGKVSF-
XPT_GEOTN       RQAGADVVGIGIVIEKAFQDGGRLLRSQGFRVVSLA---------------
XPT_OENOB       NQAGASAVGVGIVIEKRFQAGHQLILSKNLPLVSLASIDRF--EDGQVVF-
XPT_EUBR3       RMAHATVAGIGILIEKSFQPGRRKINEQGYEVYSLARIKYMD---------
XPT_STRTR       EEAGAHVEAVGIVIEKSFQDGRALLEEASYPVVSLARLERF--ENGQVVFK
XPT2_CLOPS      KQXXXXXXXXXXXXXXXFQSGRAHLEDKGIRVESLVTIDKI--EDGEVYFK
XPT2_CLOPE      KQXXXXXXXXXXXXXXXFQSGRAHLEDKGIRVESLVTIDKI--EDGEVYFK
XPT2_CLOP1      KQXXXXXXXXXXXXXXXFQSGRAHLEDKGIRVESLVTIDKI--EDGEVYFK
XPT_PARD8       EQSGAVIEGMGFIIEKAFQDGGNLLREKGIRVESLAIIDNLD---------
XPT_BACTN       EQSGAKLVGMGFIIEKAFQNGRKILEEKGVRVESLAIIE------------
XPT_LEUMM       NDXXXXXXXXXXXIEKTFQKGRQILDERGVRVESLARIKGF--ENDEVIF-
XPT_BACC2       EQXXXXXXXXXXVIEKAFQDGGKKLREQGVRVESLAEIASLD--NGTVAF-
XPT_STRMT       EQAGATVEAIGIVIEKSFQDGRDLLEKAGYPVLSLA---------------
XPT_LACRJ       DXXXXXXXXXXXXXEKSFQPGAGELKERGIRVESLARIQSL----------
XPT_LACRD       DXXXXXXXXXXXXXEKSFQPGAGELKERGIRVESLARIQSL----------
XPT_BACWK       EQXXXXXXXXXXVIEKAFQDGGKKLREQGVRVESLAEIASLDNGT------
XPT_BACCR       EQXXXXXXXXXXVIEKAFQDGGKKLREQGVRVESLAEIASLDNGT------
XPT_BACC1       EQXXXXXXXXXXVIEKAFQDGGKKLREQGVRVESLAEIASLDNGT------
XPT_STRE4       HQAGAKAVGIGIVIEKSFQAGRQLLEDLGVEVTSLARIKHFD---------
XPT_BACHK       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACCQ       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACC7       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACC0       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACAN       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACAC       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACAA       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACCZ       EQXXXXXXXXXXVIEKAFQDGGKKLREQGIRVESLAEIASLD---------
XPT_BACC4       EQXXXXXXXXXXVIEKAFQDGGKKLREQGVRVESLAEIASLDNGT------
XPT_STRS7       QQAGAKAVGIGIVIEKSFQAGRQLLEDLGVEVTSLARIKHFD--NGTVSF-
XPT_LACDB       XXXXXXXXXXXXXXXKAFQGGHDWLVNHGYHLEALASIKEF--ADGQVIF-
XPT_LACDA       XXXXXXXXXXXXXXXKAFQGGHDWLVNHGYHLEALASIKEF--ADGQVIF-
XPT_LACAC       KQAHCNIVGVGAVVAKTFQGGSDWVKDEGLRFESLASI-------------
XPT_BACC3       EQXXXXXXXXXXVIEKAFQDGGKKLREQGVRVESLA---------------
XPT_BACAH       EQXXXXXXXXXXVIEKAFQDGGKKLREQGVRVESLA---------------
XPT_AZOVD       RQAGARLVGIGIVIEKSFQPGRRALEEQGYRVESLA---------------
XPT_PORGI       EQASAKIVGMGFIIEKAFQNGREALQERGIRVESLAIIRSLD---------
XPT_PORG3       EQASAKIVGMGFIIEKAFQNGREALQERGIRVESLAIIRSLD---------
XPT_LACF3       DQXXXXXXXXXXXXXKCFQPGSAELAAKGVRVESLAKVSSL--ADGQVSFK
XPT_HELMI       RQSGAGLAGAGIVIEKLFQRGGAALRAEGMRIETLAAIERMEP--GKIVF-
XPT_LACH4       KQAECNIVGVGAVVAKTFQGGSDWVKQHGLHFEALASIDSF--KDGQVHF-
XPT_DEIRA       ADSGATLLGLGCVIEKEFEGGRQHLADLNVPIHTLANIVRMSEEEG-----
XPT_BACP2       XXXXXXXXXFGIVIEKSFQPGRDALVQMGYRVESLARIESL--EEGKVTF-
XPT_LISW6       XXXXXKVAGIGIVIEKSFQQGRELLNKTGIPVYSLARIASLENE-------
XPT_DESRM       KQADAELVGVGIVIEKAFQGGGKALRDAGVRIESLIKVSSLE---------
XPT_STRPG       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_LISIN       XXXXXKVAGIGIVIEKSFQQGRELLNKTGIPVYSLA---------------
XPT_STRPM       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRPF       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRPD       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRPC       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRPB       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRP8       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRP6       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRP3       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRP1       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_STRPZ       XXXXXXXXXXXXXXEKSFQDGRRLIEDMGIEVTSLARIKNF--ENGNLNF-
XPT_DEIGD       ALSGAELLGLGCVIEKGFEEGRAKLADLGVPILTLANILRMNEQEG-----
XPT_DEIDV       RESGAQLLGMGCVVEKAFENGRANLASLGVPVRTLANIVRMD---------
XPT_LACJO       DQANATXXXXXXXXXKEFQGGSEWVKDHGYSLEALARIS--DFENNQVHF-
XPT_LACGA       KQXXXXXXXXXXXXXKEFQGGSDWVKEHGYRLEALARISNFE---------
XPT_CLOAB       ETAGAEVSGIGIVIEKSFQKGRKCLEEKGYDIYSLARIKKL----------
XPT_CLOBB       XXXXXXXXXXXXXXXKSFQPGPKLLEEKGYDVYSLA---------------
XPT_CLOBA       XXXXXXXXXXXXXXXKSFQPGPKLLEEKGYDVYSLA---------------
XPT_CHLSY       XXXXXXXXXXXXXXEKQFQEGRLLLQKLGVPIISLAQITR-----------
XPT_CHLAA       XXXXXXXXXXXXXXEKQFQEGRLLLQKLGVPIISLAQITR-----------
PURR_BACSU      DEFNANVAGIGVLVE------------------------------------
PURR_STRR6      REFDSELAGVAV-----FADNAQEEREKQFDYKSLLKVTNID---------
PURR_STRPN      REFDSELAGVAV-----FADNAQEEREKQFDYKSLLKVTNID---------
APT_DESMR       EHFGADIVGIGVVIELEFLNGKEQLRSYG----------------------
APT_META3       RKAGAEIKDIICVIERG--DGKKIVKEKGHTVKTLMKIDVID---------
APT1_METVS      KRAGADIKDVVCIIDRG-QGKNIVEKETGYKVKTLVKIEVVD---------
APT1_METM7      KRAGADIKDVLCIIDRG---NGQNVVEEGYKVKTLVKIEVVD---------
APT2_METM5      KRAGADIRDVLCIIDRG---NGQNIVEEGYKVKTLVKIEVVD---------
APT1_METMP      KRAGADIKDVLCIIDRG---NGQNIVEEGYKVKTIVKIEVVD---------
PURR_LACLM      HEFDCLLAGVAVFLEGPFK--------------------------------
PURR_LACLA      HEFDCLLAGVAVFLEGPFK--------------------------------
APT_STRGB       RRAGAEVCGLAVLMELGFLGG------------------------------
APT_PELUB       EMSNAKIAAFVFAINLFDLGGSDNLVKKGYKVENL----------------
APT_STRCL       RRGGADVAGLAVLMELGFLGG------------------------------
APT_STRCO       RRAGAEVAGLAVLMELGF---------------------------------
APT_METTM       RXXXXXXXXXXXXIDKG--EGSRVVKERGFTVRSLVKADVVD---------
APT_METJA       KRAGAEIKDIICVIERG--EGKKIVEEKGYKIKT-----------------
APT_NOCSJ       EKCGASVHAVAILMELGFLPG------------------------------
APT_HERA2       NQLGAEVVEAAFLIELTFLGGREKLGNRPF---------------------
APT_HALMA       EDIGADIRDIVCVIKKA--DGTNKLDEAGYDAKTLINVQVIDGE-------
APT_DESAD       EKAGGKVSGMGFIAELTFLDGKSKL--------------------------
APT_METTH       REMXXXXXXXXXXXXKG--EGSRVVRERGFTVKSLVKVDVID---------
APT_STRAW       RRAGAEVAGVSVLMELGF---------------------------------
APT_SHEPA       RKLGGSVNDAAFVISLPDLGGEERLKAMDLKLISLCEFE------------
APT_TREDE       EEGGAKVVG------------------------------------------
APT_SHEHH       RQLGGSVNDAAFVISLPDLGGEQRLEKMDLKLVSLCEFE------------
APT_BACHD       EQLGGEVVGIAFMIELGYLNGRDKL--------------------------
APT_NITOC       ESLGATVAACAFVIELDFLHGRERLSD--YTVHSL----------------
APT_MARMS       TSQGASIKEVAAIIDLPDLGGSQKLRDSDIPVFSL----------------
APT_NITEU       QEAGGEVIECCFVIDLPDIGGSRRLRQQGHRLFSLCSFE------------
APT_CLOPS       EQAGGEVAGLAFTIELTELKGRDKL--KGYEVTSL----------------
APT_CLOPE       EQAGGEVAGLAFTIELTELKGRDKL--KGYEVTSL----------------
APT_CLOP1       EQAGGEVAGLAFTIELTELKGRDKL--KGYEVTSL----------------
APT_ACTSZ       NRLGGDVKHAAFVINLPDLGGGERLRKQG----------------------
APT_LACBA       EDLGGIVVGTAFLIELQDLHGRDKL--KGYDIFSL----------------
APT_SHELP       RQLGGEVEHAAFVISLPELGGEHRLAEMGLSLMTLCEFE------------
APT_DEBHA       KQTGGDIVEYLFVMELDFLNGRDKLDKPAFTLLS-----------------
APT_PASMU       QRLGGDVQDAAFVI-------------------------------------
APT_KLEP7       RRLGGEVHDAAFIINL-FDLGGEQ------RLEKLGI--------------
APT_BACSU       EELGGVVAGIAFLIELSYLDGRNKLED------------------------
APT_BACA2       EELGGVVAGIAFLIELSYLDGRDKL--------------------------
APT_LEUMM       EKLGGIVAGVAFIIELESLQGREKIMKAG-EVPFLALME------------
APT_LACPL       EELGGNVVGTAFLVELKELHGRDKIKD------------------------
APT_HALWD       DQIGAEVVDTVAVIKKA---GPNELDESDHDVKTLINVRVTD---------
APT_HALSA       EQTGADVADVLAVIKK-----------------------------------
APT_HALS3       EQTGADVADVLAVIKK-----------------------------------
APT_ACTPJ       RRLGGKVEHAAFVIWLPDLGGKERLEKEG--INSFTLVE------------
APT_ACTP7       RRLGGKVEHAAFVIWLPDLGGKERLEKEG--INSFTLVE------------
APT_ACTP2       RRLGGKVEHAAFVIWLPDLGGKERLEKEG--INSFTLVE------------
APT_THEFY       RRAGGTVVGLSVLLELGFLKGREKLAD--VELRALATV-------------
APT_MAGSA       RKIGAHVTGAGTIIDLAFLPGKQRLKE------------------------
APT_STACT       EELGGIVVGIAFIIELKYLHGIDKL--DGYDVLSL----------------
APT_SHEWM       RKLGGEVKHAAFVISLPDLGGAKRLEEMDLELVTLCEFE------------
APT_PROM4       KEAGKDITGLSVVVELG----------------------------------
APT_NITEC       QEMGGKIIECCFVIDLPGVGGSTRLRQQDHPLYSL----------------
APT_STAES       EQLGGIVVGIAFIIELKYLNGIDKIKD------------------------
APT_STAEQ       EQLGGIVVGIAFIIELKYLNGIDKIKD------------------------
APT_SHEFN       RELGGEVSHAAFVI--SLPEIGGEKRLQGMGIEVLSLCE------------
APT_KLEP3       RRLGGEVHDAAFIINL-FDLGGEQ------RLEKLGI--------------
APT_GEOSM       SSMDVELVECCFMAELEFLEGGKKLPE------------------------
APT_GEOBB       SSMDVELVECCFMAELEFLEGGKKLPE------------------------
APT_ERWCT       RRLGGTVNDAAFIINL-FDLGGEQLTEMGVTCYSL----------------
APT_BACWK       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACHK       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACCZ       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACCR       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACCQ       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACC7       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACC4       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACC2       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACC1       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACC0       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACAN       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACAH       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACAC       EELGGVVAGIAFLVELTYLDG------------------------------
APT_BACAA       EELGGVVAGIAFLVELTYLDG------------------------------
APT_SODGM       RRLGGEVQDAAFVINLAYLGGETLLNSIGVASYSLVL--------------
APT_RHORT       GKMGANVVGAACIIELSFLKG------------------------------
APT_PHOLL       RRLGGEVSEAAFIIXXXXXXXVERLQRQG--VSSFTLLEFPD---------
APT_MANSM       KRLGGDVKHAAFVINLPELGGEERLRSLG----------------------
APT_CHLAA       EMAGGQVAELAFVIELTFLNGRERLRER-----------------------
APT_BACLD       EELGGVVAGIAFLIELTYLEGRNKL--------------------------
APT_BACCN       EELGGIVAGIAFLVELTYLEGREKL--------------------------
APT_SALG2       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_PECCP       RRLGGTVNDAAFIINL-FDLGGE----------------------------
APT_LEPBL       KKLGAQIYEAGVIIDLPDLGGSKKLQEK-----------------------
APT_LEPBJ       KKLGAQIYEAGVIIDLPDLGGSKKLQEK-----------------------
APT_LACS1       EQLGGVVVGCAFIIELEDLHGRDKI--KGY--DTLALMK------------
APT_HAEIE       QRLGGTVKHAAFVI-------------------------------------
APT_BACP2       EELGGVVAGIAFLIELTYLDG------------------------------
APT_SALTY       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALTI       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALSV       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALPK       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALPC       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALPB       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALPA       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALNS       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALEP       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALDC       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALCH       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_SALA4       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_RHOOB       ESAGARVIGIAVVLEIAALGGRERLGK--YPLTSLVTV-------------
APT_PEDPA       EKLGGIVVGTAFFIE------------------------------------
APT_STRU0       EKLGGVVAGCAFLIELDGLNGRQALGDIDYKV-------------------
APT_SALHS       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_MARMM       QRAGATVVGATFIIDLPELGGAERIEAMGVPVSSLVAYE------------
APT_LACLA       EKMGGIVVGCAFLIELDELKGREKIGDYDYKV-------------------
APT_IDILO       KSSGADVVEAAFVVSLPELGGEDKLQQAG----------------------
APT1_YEAST      EQLEANLLEYNFVMELDFLKGRSKL--------------------------
PYRE_PELTS      RKSGGTVAGAGVLVDR--SNGAVDL---GVRTEALLTAE------------
APT_TREPS       ---------------------------------------------------
APT_TREPA       ---------------------------------------------------
APT_STRSY       EKLGGIVAGCAFLIELDDLKGREAIGDYDYKV-------------------
APT_STRS2       EKLGGIVAGCAFLIELDDLKGREAIGDYDYKV-------------------
APT_STRGC       ERLGGIVAGCAFLIELDELKGREVIGEYDYKV-------------------
APT_STAAW       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAU       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAT       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAS       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAR       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAN       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAM       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAE       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAC       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAAB       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAA9       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAA8       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAA3       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAA2       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_STAA1       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_SALAR       RRLGGKVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_OCEIH       EQLGGIVVGCAFLVELGYLDGKDKL--EGYDVLTL----------------
APT_METKA       ---------------------------------------------------
APT_LACLM       EKMGGVVVGCAFLIELDELKGREKIGNYDYKV-------------------
APT_EXIS2       EQLGGTVAGIGFLIELDGLGGREKL--EGYDILSL----------------
APT_STRSV       ERLGGVVAGCAFLIELDELKGREVIGDYDYKV-------------------
APT_MACCJ       ESLGGIVAGIAFIIDLKYLNGMEKL--KGYDVISLVEYE------------
APT_GEOSW       EQLGGVVAGIAFLIE------------------------------------
APT_CLOK5       EQAGGEIVTIDFVIELTDLKGREKL--KGYDVLSL----------------
APT_CLOK1       EQAGGEIVTIDFVIELTDLKGREKL--KGYDVLSL----------------
APT_CLOB8       EQAGGIVASLDFVIELTELKGKDKL--EGYDVLSL----------------
PYRE_CHLPD      KNAGALIIGVGCVVDR--SNGKVRLTDDQYAVLSMEVV-------------
APT_STRPZ       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRPM       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRPG       EKLGGIVAGCAFLIELKGLNGRHAIRNYDYKV-------------------
APT_STRPF       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRPD       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRPC       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRPB       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRP8       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRP6       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRP3       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRP1       EKLGGIVAGCAFLIELEGLNGRHAIRNYDYKV-------------------
APT_STRA1       EKLGGVVAGCAFLVE------------------------------------
APT_STAS1       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_SHESH       RNLGGKVNHAAFVI-------------------------------------
APT_RUBXD       EKSGGSVAGCAFLIELGFLEGRKKLL-AGYDVISL----------------
APT_LEUCK       EKLGGIVAGVAFIIELTDLHGREKIMQNGREVPFLTLM-------------
APT_LACLS       EKMGGVVVGCAFLIELDELKGREKIGNYVYKV-------------------
APT_HAEIN       QRLGGAVKHAAFVI-------------------------------------
APT_HAEIG       QRLGGAVKHAAFVI-------------------------------------
APT_HAEI8       QRLGGAVKHAAFVI-------------------------------------
APT_ENTS8       RRLGGEVTDAAFIINL-FDIGGEELNKQGITCYSL----------------
APT_ENT38       RRLGGEVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_ALKMQ       EELGGEVVSINFLIELGFLNGGEVL--KGYSVKSL----------------
PYRE_YARLI      DANGATVSAVVIALDR-----------------------------------
APT_VIBVY       RQLGGVVEHAAFVI--NLPEIGGDKRLEGLGLNVYSICE------------
APT_VIBVU       RQLGGVVEHAAFVI--NLPEIGGDKRLEGLGLNVYSICE------------
APT_STRZT       EKLGGVVAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_HAES2       ERLQGQVKHAAFVISLPDLGGEVRLRELG--VEPFTLVE------------
APT_HAES1       ERLQGQVKHAAFVISLPDLGGEVRLRELG--VEPFTLVE------------
APT_GEOTN       EQLGGVVAGLAFLIE------------------------------------
APT_GEOKA       EQLGGVVAGLAFLIE------------------------------------
APT_VIBHB       RQLGGEVEHAAFVI--NLPEIGGDKRLEGLGLNVYSICE------------
APT_STRZP       EKLGGVMAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_STRR6       EKLGGVMAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_STRPN       EKLGGVMAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_STRPJ       EKLGGVMAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_STRPI       EKLGGVMAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_STRP7       EKLGGVMAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_STRP2       EKLGGVMAGCAFLVELDELNGREKIGDYDYKV-------------------
APT_STRMU       ERLGGIVAGCAFLIE------------------------------------
APT_STRA5       EKLGGVVAGCAFLVE------------------------------------
APT_STRA3       EKLGGVVAGCAFLVE------------------------------------
APT_STAHJ       EKLGGIVVGIAFIIELKYLNGIEKIKD------------------------
APT_SHIFL       RRLGGEVADAAFIINL-FDLGGEQRLEK-----------------------
APT_SHIF8       RRLGGEVADAAFIINL-FDLGGEQRLEK-----------------------
APT_FUSNN       EELGGVVAGLAFLIE------------------------------------
APT_CORJK       ENAGANVCGLGVVLEVSALDGRDRLKD------------------------
APT_ASHGO       KQLGATILEFIFVMELDFLKGREKLQ-------------------------
PYRE_PROA2      KSYGGEIVGVGTVVDR--SNGKVTLADNQYSLLSLEV--------------
APT_VIBPA       RQLGGEVEHAAFVINLP-EIGGDK------RLEALGL--------------
APT_STRS7       EKLGGIVAGCAFLIE------------------------------------
APT_STREM       EKLGGIVAGCAFLIE------------------------------------
APT_STRE4       EKLGGIVAGCAFLIE------------------------------------
APT_SHISS       RRLGGEVADAAFIINL-FDLGGEQRLEK-----------------------
APT_SHIDS       RRLGGEVADAAFIINL-FDLGGEQRLEK-----------------------
APT_SHIBS       RRLGGEVADAAFIINL-FDLGGEQRLEK-----------------------
APT_SHIB3       RRLGGEVADAAFIINL-FDLGGEQRLEK-----------------------
APT_SHEDO       RQLGGQVEHAAFVI--SLPDIGGEKRLAGLGLDVFALCE------------
APT_KOSOT       EKVGGTISGIVSLVELSFLEPRKKL--SGYEVRSI----------------
APT_ESCF3       RRLGGEVTDAAFIINL-FDLGGEQRLEK-----------------------
APT_EDWI9       RRLGGVVHDAAFIID------------------------------------
APT_ECOUT       RRLGGEVADAAFIIN