[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for elen0:ACV56973.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
    8::155     1e-35  46%  192 aa  PHSB_SALTY RecName: Full=Thiosulfate reductase electron transport
    8::155     1e-35  46%  192 aa  PHSB_SALTI RecName: Full=Thiosulfate reductase electron transport
   39::224     8e-33  39%  225 aa  NRFC_HAEIN RecName: Full=Protein nrfC homolog;Flags: Precursor;
    5::157     1e-31  38%  205 aa  DMSB_ECOLI RecName: Full=Anaerobic dimethyl sulfoxide reductase
    5::157     3e-31  38%  205 aa  YNFG_ECOLI RecName: Full=Probable anaerobic dimethyl sulfoxide
    5::157     3e-31  38%  205 aa  YNFG_ECOL6 RecName: Full=Probable anaerobic dimethyl sulfoxide
    5::157     5e-31  38%  205 aa  DMSB_SHIFL RecName: Full=Anaerobic dimethyl sulfoxide reductase
   37::183     1e-30  43%  223 aa  NRFC_SHIFL RecName: Full=Protein nrfC;Flags: Precursor;
   37::183     1e-30  43%  223 aa  NRFC_ECOLI RecName: Full=Protein nrfC;Flags: Precursor;
   37::183     1e-30  43%  223 aa  NRFC_ECO57 RecName: Full=Protein nrfC;Flags: Precursor;
   54::199     7e-30  41%  239 aa  YDHX_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein
   54::199     2e-29  41%  239 aa  YDHX_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein
    5::150     2e-29  37%  191 aa  PSRB_WOLSU RecName: Full=Polysulfide reductase chain B;AltName:
  117::262     4e-29  41%  327 aa  SERB_THASE RecName: Full=Selenate reductase subunit beta;       
  118::263     2e-28  40%  328 aa  CLRB_IDEDE RecName: Full=Chlorate reductase subunit beta;AltName:
    1::157     2e-27  35%  205 aa  DMSB_HAEIN RecName: Full=Anaerobic dimethyl sulfoxide reductase
   43::232     3e-25  47%  269 aa  HMEA_ARCFU RecName: Full=Hdr-like menaquinol oxidoreductase
   39::199     1e-23  34%  370 aa  HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC operon
   28::187     8e-23  36%  294 aa  FDNH_SHIFL RecName: Full=Formate dehydrogenase, nitrate-inducible,
   28::187     8e-23  36%  294 aa  FDNH_ECOLI RecName: Full=Formate dehydrogenase, nitrate-inducible,
   31::187     5e-22  40%  300 aa  FDOH_SHIFL RecName: Full=Formate dehydrogenase-O iron-sulfur
   31::187     5e-22  40%  300 aa  FDOH_ECOLI RecName: Full=Formate dehydrogenase-O iron-sulfur
   31::187     5e-22  40%  300 aa  FDOH_ECOL6 RecName: Full=Formate dehydrogenase-O iron-sulfur
  116::229     5e-22  41%  325 aa  DDHB_RHOSU RecName: Full=Dimethylsulfide dehydrogenase subunit
   36::197     2e-21  36%  312 aa  FDXH_HAEIN RecName: Full=Formate dehydrogenase iron-sulfur
   12::170     3e-21  39%  200 aa  FDHB_WOLSU RecName: Full=Formate dehydrogenase iron-sulfur subunit;
  169::297     7e-21  38%  514 aa  NARY_ECOLI RecName: Full=Respiratory nitrate reductase 2 beta
   43::209     7e-21  40%  328 aa  HYBA_SHIFL RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
   43::209     7e-21  40%  328 aa  HYBA_ECOLI RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
   43::209     7e-21  40%  328 aa  HYBA_ECO57 RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
    2::146     2e-20  36%  639 aa  YGFT_ECOLI RecName: Full=Uncharacterized protein ygfT;
  169::281     5e-20  39%  487 aa  NARH_BACSU RecName: Full=Nitrate reductase beta chain;       
  172::294     1e-19  38%  512 aa  NARH_SHIFL RecName: Full=Respiratory nitrate reductase 1 beta
  172::294     1e-19  38%  512 aa  NARH_ECOLI RecName: Full=Respiratory nitrate reductase 1 beta
    1::151     1e-18  33%  274 aa  PGTS_PELAC RecName: Full=Pyrogallol hydroxytransferase small
    6::119     2e-17  44%  151 aa  FER8_METJA RecName: Full=Uncharacterized ferredoxin MJ0155;
    7::165     2e-16  38%  190 aa  COOF_RHORU RecName: Full=Iron-sulfur protein;
    2::151     5e-16  37%  175 aa  HYDN_ECOLI RecName: Full=Electron transport protein hydN;
    2::151     5e-16  37%  175 aa  HYDN_ECOL6 RecName: Full=Electron transport protein hydN;
    2::151     5e-16  37%  175 aa  HYDN_ECO57 RecName: Full=Electron transport protein hydN;
   61::186     9e-16  33%  208 aa  YDHY_SHIFL RecName: Full=Uncharacterized ferredoxin-like protein
   61::186     9e-16  33%  208 aa  YDHY_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein
   61::186     9e-16  33%  208 aa  YDHY_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein
    5::137     1e-15  41%  162 aa  YGFS_ECOLI RecName: Full=Putative electron transport protein ygfS;
    7::127     2e-15  38%  166 aa  FER9_METJA RecName: Full=Uncharacterized ferredoxin MJ0265;
    2::95      2e-15  41%  205 aa  HYFA_ECOLI RecName: Full=Hydrogenase-4 component A;       
    2::138     5e-15  35%  157 aa  YSAA_ECOLI RecName: Full=Putative electron transport protein ysaA;
    8::169     6e-15  37%  215 aa  FDHB_DESGI RecName: Full=Formate dehydrogenase subunit beta;       
    2::141     1e-14  36%  659 aa  AEGA_ECOLI RecName: Full=Protein aegA;
    2::95      1e-12  38%  203 aa  HYCB_SHIFL RecName: Full=Formate hydrogenlyase subunit 2;       
    2::95      1e-12  38%  203 aa  HYCB_ECOLI RecName: Full=Formate hydrogenlyase subunit 2;       
    2::95      1e-12  38%  203 aa  HYCB_ECOL6 RecName: Full=Formate hydrogenlyase subunit 2;       
   18::110     1e-12  39%  153 aa  Y264_METJA RecName: Full=Uncharacterized protein MJ0264;
    5::119     5e-12  43%  266 aa  NARH_BRASZ RecName: Full=Respiratory nitrate reductase beta chain; 
   32::134     2e-11  43%  157 aa  YFRA_PROVU RecName: Full=Frd operon probable iron-sulfur subunit
  132::209     3e-08  40%  398 aa  VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;
   44::105     6e-07  43%  105 aa  VORD_PYRHO RecName: Full=Ketoisovalerate oxidoreductase subunit
   44::105     6e-07  43%  105 aa  VORD_PYRAB RecName: Full=Ketoisovalerate oxidoreductase subunit
   17::59      2e-06  44%   70 aa  FER2_THEAC RecName: Full=Probable ferredoxin TA0517;
   59::105     2e-06  43%  105 aa  VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit
   10::51      2e-06  43%   58 aa  FER_METTE RecName: Full=Probable ferredoxin;
   17::55      2e-06  38%   62 aa  FER1_DESVM RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
   88::155     3e-06  36%  191 aa  RNFB_PSEU5 RecName: Full=Electron transport complex protein
    2::51      4e-06  33%   61 aa  FER3_DESAF RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
   17::53      4e-06  38%   59 aa  FER2_DESNO RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II;
  152::211     5e-06  39%  412 aa  MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;
  233::366     7e-06  32%  394 aa  VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;
   40::142     9e-06  34%  250 aa  Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like
   55::94      9e-06  38%  501 aa  Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like
    3::57      9e-06  35%  116 aa  FER_RICCN RecName: Full=Ferredoxin;
   88::155     1e-05  33%  191 aa  RNFB_PSEMY RecName: Full=Electron transport complex protein rnfB;
   70::157     1e-05  48%  163 aa  NUOI_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit I;    
  152::195     2e-05  37%  412 aa  MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;
   78::139     3e-05  35%  157 aa  VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;
   81::124     3e-05  34%  131 aa  FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;
   70::114     3e-05  61%  163 aa  NUOI_VESOH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   67::116     3e-05  47%  165 aa  NUOI_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     4e-05  58%  162 aa  NUOI_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::114     6e-05  61%  163 aa  NUOI_THICR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     6e-05  58%  162 aa  NUOI_SPHAL RecName: Full=NADH-quinone oxidoreductase subunit I;    
   71::115     6e-05  58%  164 aa  NUOI_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit I;    
    3::56      6e-05  33%   78 aa  FER_BACSC RecName: Full=Ferredoxin 7Fe;AltName: Full=Seven-iron
   70::114     7e-05  58%  163 aa  NUOI_RALME RecName: Full=NADH-quinone oxidoreductase subunit I;    
   67::116     7e-05  44%  165 aa  NUOI_METPP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   76::120     7e-05  56%  169 aa  NUOI_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   74::118     7e-05  56%  167 aa  NUOI_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   71::115     7e-05  56%  164 aa  NUOI_DINSH RecName: Full=NADH-quinone oxidoreductase subunit I;    
    3::51      7e-05  33%  112 aa  FER2_RHOCA RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II; 
  335::384     1e-04  40%  431 aa  Y1684_METTH RecName: Full=Uncharacterized protein MTH_1684;
   15::86      1e-04  31%   86 aa  PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:
   66::110     1e-04  58%  159 aa  NUOI_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit I;    
   66::110     1e-04  58%  159 aa  NUOI_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   66::110     1e-04  58%  159 aa  NUOI_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   66::110     1e-04  58%  159 aa  NUOI_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
    8::52      1e-04  36%   60 aa  FER_METTL RecName: Full=Ferredoxin;
   65::114     1e-04  47%  163 aa  NUOI_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   64::123     1e-04  40%  163 aa  NUOI_COXBU RecName: Full=NADH-quinone oxidoreductase subunit I;    
   64::123     1e-04  40%  163 aa  NUOI_COXBR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   64::123     1e-04  40%  163 aa  NUOI_COXBN RecName: Full=NADH-quinone oxidoreductase subunit I;    
    3::51      1e-04  31%  110 aa  FER_RICTY RecName: Full=Ferredoxin;
   15::62      1e-04  44%   78 aa  FER_ALIAC RecName: Full=Ferredoxin;
   71::115     2e-04  56%  164 aa  NUOI_SILST RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::114     2e-04  53%  163 aa  NUOI_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::114     2e-04  56%  163 aa  NUOI_PARDP RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::112     2e-04  56%  161 aa  NUOI_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     2e-04  58%  162 aa  NUOI_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit I;    
   63::113     2e-04  46%  162 aa  NUOI_BEII9 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   63::112     2e-04  47%  161 aa  NUOI_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit I;    
   74::118     2e-04  56%  167 aa  NUOI1_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
   74::118     2e-04  56%  167 aa  NUOI1_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
   70::114     2e-04  56%  163 aa  NQO9_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 9;    
  129::173     2e-04  56%  222 aa  NDUS8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone]
   39::122     2e-04  40%  355 aa  FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;
    3::51      2e-04  31%  109 aa  FER_RICPR RecName: Full=Ferredoxin;
    3::51      2e-04  31%  107 aa  FER_RICBR RecName: Full=Ferredoxin;
   71::115     2e-04  53%  164 aa  NUOI_SILPO RecName: Full=NADH-quinone oxidoreductase subunit I;    
   71::115     2e-04  53%  164 aa  NUOI_JANSC RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::113     2e-04  58%  162 aa  NUOI1_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
  137::181     2e-04  53%  230 aa  NDUS8_TOBAC RecName: Full=NADH dehydrogenase [ubiquinone]
  136::180     2e-04  53%  229 aa  NDUS8_SOLTU RecName: Full=NADH dehydrogenase [ubiquinone]
    8::48      2e-04  44%   58 aa  FER6_METJA RecName: Full=Uncharacterized ferredoxin MJ0624;
    2::50      2e-04  31%  106 aa  FER2_RHORU RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II; 
    3::51      2e-04  31%  113 aa  FER1_CAUCR RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
  166::200     3e-04  46%  246 aa  Y208_METJA RecName: Full=Uncharacterized protein MJ0208;
   88::156     3e-04  26%  190 aa  RNFB_SODGM RecName: Full=Electron transport complex protein rnfB;
   68::113     3e-04  56%  162 aa  NUOI_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   66::110     3e-04  56%  159 aa  NUOI_RICTY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_RHILW RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::115     3e-04  56%  164 aa  NUOI_RHILO RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   67::116     3e-04  42%  165 aa  NUOI_POLNA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   78::133     3e-04  45%  186 aa  NUOI_PELPD RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::113     3e-04  56%  162 aa  NUOI_METSB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_MESSB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::114     3e-04  58%  163 aa  NUOI_HALHL RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUME RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUMB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BRUA1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BART1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BARHE RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_BARBK RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::113     3e-04  56%  162 aa  NUOI_AZOC5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_AGRVS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     3e-04  56%  163 aa  NUOI_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   70::115     3e-04  56%  164 aa  NUOI1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
   69::114     3e-04  56%  163 aa  NUOI1_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
    4::64      3e-04  40%   79 aa  FER_THET8 RecName: Full=Ferredoxin;
   10::55      3e-04  37%   62 aa  FER4_METJA RecName: Full=Uncharacterized ferredoxin MJ0199;
    3::51      3e-04  31%   93 aa  FER1_AFIFE RecName: Full=Ferredoxin-1;Flags: Fragment;
   90::156     4e-04  29%  187 aa  RNFB_AERHH RecName: Full=Electron transport complex protein rnfB;
   66::110     4e-04  53%  159 aa  NUOI_RICPR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     4e-04  56%  162 aa  NUOI_HERAR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     4e-04  56%  162 aa  NUOI_DECAR RecName: Full=NADH-quinone oxidoreductase subunit I;    
   78::150     4e-04  37%  183 aa  NUOI_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   71::115     4e-04  53%  164 aa  NUOI_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   72::121     4e-04  44%  170 aa  NUOI_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   64::113     4e-04  44%  162 aa  NUOI2_NITMU RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
  591::633     4e-04  40%  659 aa  HDRA_METTM RecName: Full=CoB--CoM heterodisulfide reductase
  592::634     4e-04  40%  659 aa  HDRA_METTH RecName: Full=CoB--CoM heterodisulfide reductase
  577::648     4e-04  33%  793 aa  HDRA_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1
    3::51      4e-04  31%  109 aa  FER_RICFE RecName: Full=Ferredoxin;
   53::158     5e-04  36%  166 aa  Y1043_HAEIN RecName: Full=Uncharacterized protein HI1043;
   28::48      5e-04  62%  421 aa  PHFL_DESVO RecName: Full=Periplasmic [Fe] hydrogenase large
   66::110     5e-04  53%  159 aa  NUOI_RICFE RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     5e-04  53%  162 aa  NUOI_RHORT RecName: Full=NADH-quinone oxidoreductase subunit I;    
   64::113     5e-04  44%  162 aa  NUOI_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   67::111     5e-04  53%  160 aa  NUOI_ANAMM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::114     5e-04  56%  163 aa  NUOI_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit I;    
  117::161     5e-04  56%  210 aa  NDUS8_MACFA RecName: Full=NADH dehydrogenase [ubiquinone]
  119::163     5e-04  56%  212 aa  NDUS8_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone]
   14::50      5e-04  41%   55 aa  FER_CLOTS RecName: Full=Ferredoxin;
    8::54      5e-04  36%   83 aa  FER_CHRVI RecName: Full=Ferredoxin;
   81::171     6e-04  34%  408 aa  Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like
   86::154     6e-04  31%  188 aa  RNFB_THIDA RecName: Full=Electron transport complex protein rnfB;
   29::95      6e-04  33%   95 aa  PORD_METBF RecName: Full=Pyruvate synthase subunit porD;AltName:
   69::113     6e-04  50%  162 aa  NUOI_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::112     6e-04  53%  161 aa  NUOI_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::112     6e-04  53%  161 aa  NUOI_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     6e-04  53%  162 aa  NDUS8_RECAM RecName: Full=NADH-ubiquinone oxidoreductase subunit 8;
  117::161     6e-04  53%  210 aa  NDUS8_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
  117::161     6e-04  53%  210 aa  NDUS8_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
  119::163     6e-04  53%  212 aa  NDUS8_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
  117::161     6e-04  53%  210 aa  NDUS8_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
  117::161     6e-04  53%  210 aa  NDUS8_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
  577::653     6e-04  30%  793 aa  HDRA_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1
    4::58      6e-04  29%  510 aa  GLUS_METJA RecName: Full=Glutamate synthase;         EC=1.4.1.13;
  494::548     8e-04  35%  620 aa  Y870_METJA RecName: Full=Uncharacterized protein MJ0870;
   89::158     8e-04  29%  188 aa  RNFB_YERPN RecName: Full=Electron transport complex protein rnfB;
   89::158     8e-04  29%  188 aa  RNFB_YERPG RecName: Full=Electron transport complex protein rnfB;
   89::158     8e-04  29%  188 aa  RNFB_YERPE RecName: Full=Electron transport complex protein rnfB;
   89::158     8e-04  29%  188 aa  RNFB_YERPA RecName: Full=Electron transport complex protein rnfB;
  109::160     8e-04  35%  169 aa  RNFB_BUCBP RecName: Full=Electron transport complex protein rnfB;
   90::156     8e-04  27%  187 aa  RNFB_AERS4 RecName: Full=Electron transport complex protein rnfB;
   71::120     8e-04  42%  169 aa  NUOI_VEREI RecName: Full=NADH-quinone oxidoreductase subunit I;    
   84::128     8e-04  50%  177 aa  NUOI_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit I;    
   69::113     8e-04  50%  162 aa  NUOI_MARMM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   73::122     8e-04  42%  171 aa  NUOI_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit I;    
  567::613     8e-04  47%  623 aa  IORA_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN
PHSB_SALTY      ---YVMLHDEKRCIGCQACTVACKVLNDVPEGFSRVQVQIRAPEQASNALTHFQ-----FVRVSCQHCEN
PHSB_SALTI      ---YVMLHDEKRCIGCQACTVACKVLNDVPEGFSRVQVQIRAPEQASNALTHFQ-----FVRVSCQHCEN
NRFC_HAEIN      ---YAMIHDENACIGCTACMDSCRDVNQVPEGVSRLEILRSEPY------GEFPNQEYEFFRQSCQHCTN
DMSB_ECOLI      ---YGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWQNVFAYYLSISCNHCED
YNFG_ECOLI      ---YGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWQNVFAYYLSISCNHCDD
YNFG_ECOL6      ---YGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWQNVFAYYLSISCNHCDD
DMSB_SHIFL      ---YGFFIDSSRCAGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWQNVFAYYLSISCNHCED
NRFC_SHIFL      ---YGMVHDESLCIGCTACMDACREVNKVPEGVSRLTIIRSEPQ------GEFPDVKYRFFRKSCQHCDH
NRFC_ECOLI      ---YGMVHDESLCIGCTACMDACREVNKVPEGVSRLTIIRSEPQ------GEFPDVKYRFFRKSCQHCDH
NRFC_ECO57      ---YGMVHDESLCIGCTACMDACREVNKVPEGVSRLTIIRSEPQ------GEFPDVKYRFFRKSCQHCDH
YDHX_ECOLI      ---YAMIHDESRCNGCNICARACRKTNHVPAQG---SRLSIAHIPVTDNDN---ETQYHFFRQSCQHCED
YDHX_ECO57      ---YAMIHDESRCNGCNICARACRKTNHAPAQG---SRLSIAHIPVTDNDN---ETQYHFFRQSCQHCED
PSRB_WOLSU      ---YGMIHDENLCIGCQACNIACRSENKIPDSVYRLQVWVQGPKKLPDGTLSFN-----YHRQSCVQCEN
SERB_THASE      ------------------------------------------------GKGEFPNNHYFYLPRICNHCSN
CLRB_IDEDE      ------------------------------------------------GKGEFPNNHSFYLPRICNHCSN
DMSB_HAEIN      MEQYGFYFDSERCTGCKTCELACKDYKGTEVNFRRIYEYTGGQWNQQADGCWHQNIFAYYMSISCNHCAD
HMEA_ARCFU      ---WAMAVDVERCTQCMECVVACDKENNVEEERFDPQWMRIAKLKLDK-----PEVKEYYIPLLCNHCEH
HMC2_DESVH      --SYGVLHDTTRCIGCRKCEQACNEVNKLPAPKAKFDDLTVLEKTRRTDADSWTVVNRYFRKQQCNHCLE
FDNH_SHIFL      -AEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMKLEWLIRKDGCMHCED
FDNH_ECOLI      -AEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMKLEWLIRKDGCMHCED
FDOH_SHIFL      ----AKLIDVTTCIGCKACQVACSEWNGNNIGVY------DNPNDLSAKSWTFSEVEQLIRKDGCMHCSD
FDOH_ECOLI      ----AKLIDVTTCIGCKACQVACSEWNGNNIGVY------DNPNDLSAKSWTFSEVEQLIRKDGCMHCSD
FDOH_ECOL6      ----AKLIDVTTCIGCKACQVACSEWNGNNIGVY------DNPNDLSAKSWTFSEVEQLIRKDGCMHCSD
DDHB_RHOSU      ------------------------------------------------GRGEYPNSYYFYLPRICNHCAN
FDXH_HAEIN      ----AKLIDVSTCIGCKACQVGCSEWNDIDINA---QCVGVYDNPVDLDAKAW--TVMRFNEVECMHCTE
FDHB_WOLSU      --------DEARCIDCHGCDVACKEAHHLPVGVNRRRVVTLN----EGLVGKEKS-----LSIACMHCSD
NARY_ECOLI      --------------------------------------------------GQFENTFMMYLPRLCEHCLN
HYBA_SHIFL      --------DSTLCVGCQACVTKCQDINFPERNQTWSNNDKLSPYTNNSGTGVNKDQEYAYIKKQCMHCVD
HYBA_ECOLI      --------DSTLCVGCQACVTKCQDINFPERNQTWSNNDKLSPYTNNSGTGVNKDQEYAYIKKQCMHCVD
HYBA_ECO57      --------DSTLCVGCQACVTKCQDINFPERNQTWSNNDKLSPYTNNSGTGVNKDQEYAYIKKQCMHCVD
YGFT_ECOLI      --NKFIAAEAAECIGCHACEIACAVAHNQENWPLSHSDFRPRIHVVGKGQAANP--------VACHHCNN
NARH_BACSU      ----------------------------------------------------FDDVFMMYLPRICEHCIN
NARH_SHIFL      ----------------------------------------------------FENTFMMYLPRLCEHCLN
NARH_ECOLI      ----------------------------------------------------FENTFMMYLPRLCEHCLN
PGTS_PELAC      MEQYYMVIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQRGHRWMNRERGTYPRNDINYRPTPCMHCEN
FER8_METJA      -----IVLNPEKCTKCYDCINICKEIHGES---------RV--RKVDG------------IPIFCMQCEN
COOF_RHORU      --NVIIYANPDHCLSCHSCELACAVAHSG------------GHDMIEAIAANLPSVDGTAMPMQCRQCED
HYDN_ECOLI      --NRFIIADASKCIGCRTCEVACVVSHNQDCASLTPETFLPRIHVIKGVNISTATV--------CRQCED
HYDN_ECOL6      --NRFIIADASKCIGCRTCEVACVVSHNQDCASLTPETFLPRIHVIKGVNISTATV--------CRQCED
HYDN_ECO57      --NRFIIADASKCIGCRTCEVACVVSHNQDCASLTPETFLPRIHVIKGVNISTATV--------CRQCED
YDHY_SHIFL      -----LVTQRARCTGCHRCEISCTNFNDGSVGTFFS---RIKIHXXXXXXXXXXXXXXXXTADTCRQCKE
YDHY_ECOLI      -----LVTQRARCTGCHRCEISCTNFNDGSVGTFFS---RIKIHXXXXXXXXXXXXXXXXTADTCRQCKE
YDHY_ECO57      -----LVTQRARCTGCHRCEISCTNFNDGSVGTFFS---RIKIHXXXXXXXXXXXXXXXXTADTCRQCKE
YGFS_ECOLI      -----IIVNPADCIGCRTCEVAC-----------------VVAHPSENADVFLPRLKVQRLPVMCHQCEN
FER9_METJA      -----IMTNFN-CDNCGDCVKACMEKNKV-------------------GRIAIMEKDGKYIPIVCQHCAS
HYFA_ECOLI      --NRFVVAEPLWCTGCNTCLAACSDVH---------KTQGLQQHPRLALAKT----STITAPVVCHHCEE
YSAA_ECOLI      --NRFIIADATKCIGCRTCEVACA----------------VSHHENQDCAALSPDEHCWTTAVACHQCED
FDHB_DESGI      --------DTTRCTACRGCQVACKQWHGPDFNFHTYKLVRMHEQEIDGR------IDWLFFPDQCRHCIA
AEGA_ECOLI      --NRFIMANSQQCLGCHACEIACVMAHNVLSQHHFHPRITVIKHQQQRSA------------VTCHHCED
HYCB_SHIFL      --NRFVIADSTLCIGCHTCEAACSETHRQH-GLQSMPRLRVMLNEKESA------------PQLCHHCED
HYCB_ECOLI      --NRFVIADSTLCIGCHTCEAACSETHRQH-GLQSMPRLRVMLNEKESA------------PQLCHHCED
HYCB_ECOL6      --NRFVIADSTLCIGCHTCEAACSETHRQH-GLQSMPRLRVMLNEKESA------------PQLCHHCED
Y264_METJA      -----VVVNVGSCIGCRRCERSCP-INGITFNEF---------------------------PIKCMHCDR
NARH_BRASZ      -----MVLNLDKCIGCHTCSVTCK--EGMEYA--W-----------------FNNVESKL----CEHCLN
YFRA_PROVU      --------------------------------------------------------------VVCHQCED
VHUB_METVO      ----------------------------------------------------------------CVGCS-
VORD_PYRHO      -----------------------------------------------------------FMPVKCVKCYI
VORD_PYRAB      -----------------------------------------------------------FMPVKCVKCYI
FER2_THEAC      ----------------------------------------------------------------CNYCG-
VORD_PYRFU      ----------------------------------------------------------------------
FER_METTE       ----------------------------------------------------------------CTGCGS
FER1_DESVM      ----------------------------------------------------------------------
RNFB_PSEU5      --------------------------------------LDVEPEPLDAEGGEKPQMVAYIREAECIGCT-
FER3_DESAF      ----------------------------------------------------------YKITIDTDKCTG
FER2_DESNO      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
VHUB_METJA      -----IVIPPKSCPACKLCVNICP------VDALDLEVKLSSPHPITDEGLVIVEEDFEVLK--------
Y514_METJA      ---------------------------------------------------------LYINETKCIRCNL
Y1303_METJA     ----------------------------------------------------------------------
FER_RICCN       ----------------------------------------------------------YVVTDECVKCKY
RNFB_PSEMY      --------------------------------------LDVEPEPLDAVEGEKPQMVAFIREAECIGCT-
NUOI_RUTMC      ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
FER2_METJA      ---------------------------------------------------------------KCVHCGC
NUOI_VESOH      ----------------------------------------------------------------------
NUOI_POLSJ      --------------------------------------------------------------IACKLCE-
NUOI_ERYLH      ----------------------------------------------------------------------
NUOI_THICR      ----------------------------------------------------------------------
NUOI_SPHAL      ----------------------------------------------------------------------
NUOI_ROSDO      ----------------------------------------------------------------------
FER_BACSC       ----------------------------------------------------------YVITEPCIGTKD
NUOI_RALME      ----------------------------------------------------------------------
NUOI_METPP      --------------------------------------------------------------IACKLCE-
NUOI_EHRCR      ----------------------------------------------------------------------
NUOI_EHRCJ      ----------------------------------------------------------------------
NUOI_DINSH      ----------------------------------------------------------------------
FER2_RHOCA      ----------------------------------------------------------YVVTDNCIACKY
Y1684_METTH     ------------------------------------------------------DVRPVHHPERCTDCAV
PORD_METJA      ---------------------------------------------IKNKTGTWRTFRPILDNEKCVKCEN
NUOI_NEIMF      ----------------------------------------------------------------------
NUOI_NEIMB      ----------------------------------------------------------------------
NUOI_NEIMA      ----------------------------------------------------------------------
NUOI_NEIG1      ----------------------------------------------------------------------
FER_METTL       ---------------------------------------------------------------KCKGPEC
NUOI_RALEJ      --------------------------------------------------------------IACKLCE-
NUOI_COXBU      --------------------------------------------------------------IACKLCEA
NUOI_COXBR      --------------------------------------------------------------IACKLCEA
NUOI_COXBN      --------------------------------------------------------------IACKLCEA
FER_RICTY       ----------------------------------------------------------YIVTDECVKCKY
FER_ALIAC       ----------------------------------------------------------------------
NUOI_SILST      ----------------------------------------------------------------------
NUOI_RHOCA      ----------------------------------------------------------------------
NUOI_PARDP      ----------------------------------------------------------------------
NUOI_NOVAD      ----------------------------------------------------------------------
NUOI_CHRVO      ----------------------------------------------------------------------
NUOI_BEII9      --------------------------------------------------------------IACKLCEA
NUOI_AZOSE      --------------------------------------------------------------IACKLCE-
NUOI1_RHOS4     ----------------------------------------------------------------------
NUOI1_RHOS1     ----------------------------------------------------------------------
NQO9_PARDE      ----------------------------------------------------------------------
NDUS8_ARATH     ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
FER_RICPR       ----------------------------------------------------------YVVTDECVKCKY
FER_RICBR       ----------------------------------------------------------YVVTDECVKCKY
NUOI_SILPO      ----------------------------------------------------------------------
NUOI_JANSC      ----------------------------------------------------------------------
NUOI1_RHOPA     ----------------------------------------------------------------------
NDUS8_TOBAC     ----------------------------------------------------------------------
NDUS8_SOLTU     ----------------------------------------------------------------------
FER6_METJA      ---------------------------------------------------------------KCVGCGN
FER2_RHORU      ----------------------------------------------------------YVVTENCIKCKY
FER1_CAUCR      ----------------------------------------------------------YIVTDACVRCKF
Y208_METJA      ----------------------------------------------------------------------
RNFB_SODGM      --------------------------------------LSVDPQPMDGEASSRPESRVAWIDENCIGCT-
NUOI_XANP2      ----------------------------------------------------------------------
NUOI_RICTY      ----------------------------------------------------------------------
NUOI_RHILW      ----------------------------------------------------------------------
NUOI_RHILO      ----------------------------------------------------------------------
NUOI_RHIL3      ----------------------------------------------------------------------
NUOI_POLNA      --------------------------------------------------------------IACKLCE-
NUOI_PELPD      --------------------------------------------------------------VQCVSCNM
NUOI_OCHA4      ----------------------------------------------------------------------
NUOI_METSB      ----------------------------------------------------------------------
NUOI_MESSB      ----------------------------------------------------------------------
NUOI_HALHL      ----------------------------------------------------------------------
NUOI_BRUSU      ----------------------------------------------------------------------
NUOI_BRUSI      ----------------------------------------------------------------------
NUOI_BRUO2      ----------------------------------------------------------------------
NUOI_BRUME      ----------------------------------------------------------------------
NUOI_BRUMB      ----------------------------------------------------------------------
NUOI_BRUC2      ----------------------------------------------------------------------
NUOI_BRUAB      ----------------------------------------------------------------------
NUOI_BRUA2      ----------------------------------------------------------------------
NUOI_BRUA1      ----------------------------------------------------------------------
NUOI_BART1      ----------------------------------------------------------------------
NUOI_BARHE      ----------------------------------------------------------------------
NUOI_BARBK      ----------------------------------------------------------------------
NUOI_AZOC5      ----------------------------------------------------------------------
NUOI_AGRVS      ----------------------------------------------------------------------
NUOI_AGRT5      ----------------------------------------------------------------------
NUOI1_RHIME     ----------------------------------------------------------------------
NUOI1_RHIEC     ----------------------------------------------------------------------
FER_THET8       --------------------------------------------------------------VICEPCKD
FER4_METJA      ----------------------------------------------------------------CKGAEC
FER1_AFIFE      ----------------------------------------------------------YVVTENCIKCKY
RNFB_AERHH      ----------------------------------------VEPQPLGGAEAAAPIKKVAFIHEQCIGCT-
NUOI_RICPR      ----------------------------------------------------------------------
NUOI_HERAR      ----------------------------------------------------------------------
NUOI_DECAR      ----------------------------------------------------------------------
NUOI_CHLT3      ----------------------------------------------------------------------
NUOI_ANAPZ      ----------------------------------------------------------------------
NUOI_ACISJ      --------------------------------------------------------------IACKLCE-
NUOI2_NITMU     --------------------------------------------------------------IACKLCE-
HDRA_METTM      ----------------------------------------------------------------CGGCE-
HDRA_METTH      ----------------------------------------------------------------CGGCE-
HDRA_METMA      -------------------------------------------------------------PDKCIGCRT
FER_RICFE       ----------------------------------------------------------YVVNDECVKCKY
Y1043_HAEIN     ------------CNGCGECASACQATLEIDYAPCDLKCAEVCPHPFPGDTLLRPQFSSACLILQNQTC--
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_RICFE      ----------------------------------------------------------------------
NUOI_RHORT      ----------------------------------------------------------------------
NUOI_BORA1      --------------------------------------------------------------IACKLCE-
NUOI_ANAMM      ----------------------------------------------------------------------
NUOI_ALHEH      ----------------------------------------------------------------------
NDUS8_MACFA     ----------------------------------------------------------------------
NDUS8_BOVIN     ----------------------------------------------------------------------
FER_CLOTS       ----------------------------------------------------------------------
FER_CHRVI       ----------------------------------------------------------------------
Y51B_METJA      ------VIDEGSCVACANCIEVCPT--GV---------LEMDKHRVET-EGLFFDKPKYSNLIVCVRCGN
RNFB_THIDA      --------------------------------------LGVEPKPLDEAHGTPKPKSVAFIDEQCIGCTL
PORD_METBF      -----------------------------------------------GGWRNFRPVYIYEKCTKCGICHI
NUOI_MAGSA      ----------------------------------------------------------------------
NUOI_HYPNA      ----------------------------------------------------------------------
NUOI_AZOSB      ----------------------------------------------------------------------
NDUS8_RECAM     ----------------------------------------------------------------------
NDUS8_PONAB     ----------------------------------------------------------------------
NDUS8_PANTR     ----------------------------------------------------------------------
NDUS8_MOUSE     ----------------------------------------------------------------------
NDUS8_HUMAN     ----------------------------------------------------------------------
NDUS8_GORGO     ----------------------------------------------------------------------
HDRA_METAC      -------------------------------------------------------------PDKCIGCRT
GLUS_METJA      ----------------------------------------------------------------------
Y870_METJA      ---------------------------------------------------------------KCNGCGR
RNFB_YERPN      --------------------------------------LAVEPQPLDGDSAAHPQRKVAFIDANCIGCT-
RNFB_YERPG      --------------------------------------LAVEPQPLDGDSAAHPQRKVAFIDANCIGCT-
RNFB_YERPE      --------------------------------------LAVEPQPLDGDSAAHPQRKVAFIDANCIGCT-
RNFB_YERPA      --------------------------------------LAVEPQPLDGDSAAHPQRKVAFIDANCIGCT-
RNFB_BUCBP      ----------------------------------------------------------------------
RNFB_AERS4      ----------------------------------------VDPQPLGSAEAAIPVKKVAFIHEQCIGCT-
NUOI_VEREI      --------------------------------------------------------------IACKLCE-
NUOI_RHOFD      ----------------------------------------------------------------------
NUOI_MARMM      ----------------------------------------------------------------------
NUOI_ACIAC      --------------------------------------------------------------IACKLCE-
IORA_ARCFU      ----------------------------------------------------------YKVTEDCTLCM-


                         .         .         *         .         .         .         .:140
query           PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCV
PHSB_SALTY      APCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADKCNFCDTRLAAGQSPACV
PHSB_SALTI      APCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADKCNFCDTRLAAGQSPACV
NRFC_HAEIN      APCVAVCPTGASFIKETGIVDVHKDLCIGCQYCIAVCPYRVRFIHPIHRTADKCNFCDTNLANGKQPACV
DMSB_ECOLI      PACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETKGHMTKCDGCYDRVAEGKKPICV
YNFG_ECOLI      PACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICV
YNFG_ECOL6      PACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICV
DMSB_SHIFL      PACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETKGHMTKCDGCYDRVAEGKKPICV
NRFC_SHIFL      APCVDVCPTGAS-FRDSGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKNLQAGKLPACV
NRFC_ECOLI      APCVDVCPTGAS-FRDSGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKNLQAGKLPACV
NRFC_ECO57      APCVDVCPTGAS-FRDSGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKNLQAGKLPACV
YDHX_ECOLI      APCIDVCPTGASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADKCDFCESRLAKGFPPICV
YDHX_ECO57      APCIDVCPTGASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADKCDFCESRLAKGFPPICV
PSRB_WOLSU      TPCVSVCPTKASYVNEDGIVSVNVDLCVGCLYCIAACPYQARYVDPVTKAPDKCNFCDTRLARGEEPACV
SERB_THASE      PACLAACPTKAIYKREDGLVVVDQSRCKGYRYCVKACPYGKMYFNLQKGTSEKCIGCYPRVEKGEAPACV
CLRB_IDEDE      PACLAACPTKAIYKREDGIVVVDQTRCRGYRYCVKACPYGKMYFNLQKGKSEKCIGCYPRVEKGEAPACV
DMSB_HAEIN      PACTKVCPTGAMHKNADGFVIVNEEICIGCRYCHMACPYDAPQYDAQKGHMTKCDGCYSRVKSGQKPICV
HMEA_ARCFU      PPCVQVCLTKASFKRPDGIVEIDMHRCIGCRYCMIACPYGARCFNRTEGVVEKCTFCVHRIDEGEIPACV
HMC2_DESVH      PACASACFVKAFTKNPDGSVTYDGSLCVGCRYCMVACPFNVQYAEAFDPLIQKCTMCHPRLAEGKLPGCV
FDNH_SHIFL      PGCLKACPSAGAIIQANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACV
FDNH_ECOLI      PGCLKACPSAGAIIQANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACV
FDOH_SHIFL      PGCLKACPAEGAIIQANGIVDFQSEQCIGCGYCIAGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACV
FDOH_ECOLI      PGCLKACPAEGAIIQANGIVDFQSEQCIGCGYCIAGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACV
FDOH_ECOL6      PGCLKACPAEGAIIQANGIVDFQSEQCIGCGYCIAGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACV
DDHB_RHOSU      PGCLAACARNAIYKREDGIVLVDQERCRGYRYCITACPYKKVYFNEQISKAEKCIFCYPRIEKGLPTACA
FDXH_HAEIN      PGCLKACPAPGAIIQANGIVDFQSDKCIGCGYCIAGCPFNIPRMNPEDNRVYKCTLCVDRVSVGQEPACV
FDHB_WOLSU      APCAQVCPVDCFYVRADGIVLHDKEKCIGCGYCLYACPFGAPQFPKSRGPMDKCTFCQNRIAEGKVPVCA
NARY_ECOLI      PSCVATCPSGAIYKREDGIVLIDQDKCRGWRLCISGCPYKKIYFNWKSGKSEKCIFCYPRIESGQPTVCS
HYBA_SHIFL      PNCVSVCPVSA--LKKDGIVHYDKDVCTGCRYCMVACPYNVKYYNNPFGALHKCELCNQRLDKGGLPGCV
HYBA_ECOLI      PNCVSVCPVSA--LKKDGIVHYDKDVCTGCRYCMVACPYNVKYYNNPFGALHKCELCNQRLDKGGLPGCV
HYBA_ECO57      PNCVSVCPVSA--LKKDGIVHYDKDVCTGCRYCMVACPYNVKYYNNPFGALHKCELCNQRLDKGGLPGCV
YGFT_ECOLI      APCVTACPVNALTFQSD-SVQLDEQKCIGCKRCAIACPFGV--VEMVDTIAQKCDLCNQRSSGTQ--ACI
NARH_BACSU      PACVSSCPSGAMYKREDGIVLVDQNACRSWRYCVSSCPYKKVYFNWQTNKAEKCTLCFPRLEAGLPTICS
NARH_SHIFL      PACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCS
NARH_ECOLI      PACVATCPSGAIYKREDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCS
PGTS_PELAC      APCVAK-GNGAVYQREDGIVLIDPEKAKGKKELLDTCPYGVMYWNEEENVAQKCTMCAHLLDDPKMPRCA
FER8_METJA      APCKEICPVDAIYLKD-GIPIVDKERCIACGMCAIACPIGAIFI--KNRVAHKCTLCVDRIT----PACV
COOF_RHORU      APCTFACPTGACR-QADGQVQIVEQHCIGCKLCVMVCPFGAITVRSERGVAKKCDLCDWRASTGKAPACV
HYDN_ECOLI      APCANVCPNGAIS-RDKGFVHVMQERCIGCKTCVVACPYGAMNVRADKAEANKCDLCNHR---EDGPACM
HYDN_ECOL6      APCANVCPNGAIS-RDKGFVHVMQERCIGCKTCVVACPYGAMNVRADKAEANKCDLCNHR---EDGPACM
HYDN_ECO57      APCANVCPNGAIS-RDKGFVHVMQERCIGCKTCVVACPYGAMNVRADKAEANKCDLCNHR---EDGPACM
YDHY_SHIFL      PQCMNVCPIGATWQQKEGCITVDHKRCIGCSACTTACPWMMATVNTESKKSSKCVLC-------------
YDHY_ECOLI      PQCMNVCPIGATWQQKEGCITVDHKRCIGCSACTTACPWMMATVNTESKKSSKCVLC-------------
YDHY_ECO57      PQCMNVCPIGATWQQKEGCITVDHKRCIGCSACTTACPWMMATVNTESKKSSKCVLC-------------
YGFS_ECOLI      APCVGACPVGALTMGEQ-VVQTNSARCIGCQSCVSACPFGMITIGDTRQQIVKCDLCEQR---EEGPACV
FER9_METJA      APCKEVCPVSAIEHKD-GYVYLNEDVCIGCGLCALACPFGAILM---EDKAYKCILC-----NGDEPACV
HYFA_ECOLI      APCLQVCPVNAISQRDDA-IQLNESLCIGCKLCAVVCPFG------------------------------
YSAA_ECOLI      APCANVCPVDAIS-REHGHIFVEQTRCIGCKSCMLACPFGAMEVSRKKARAIKCDLCWHRETG---PACV
FDHB_DESGI      PPCKATADMESAIIHDDATGCVPKTKDLDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACV
AEGA_ECOLI      APCARSCPNGASHV--DDSIQVNQQKCIGCKSCVVACPFGTMQIGKVKATAHKCDLCAGRENG---PACV
HYCB_SHIFL      APCAVVCPVNAI-TRVDGAVQLNESLCVSCKLCGIACPFG------------------------------
HYCB_ECOLI      APCAVVCPVNAI-TRVDGAVQLNESLCVSCKLCGIACPFG------------------------------
HYCB_ECOL6      APCAVVCPVNAI-TRVDGAVQLNESLCVSCKLCGIACPFG------------------------------
Y264_METJA      NPCLYACPENAIE-RINNKVVVIKDKCVGCGLCALACPFGAIRI---DGVAIKCNGCYKR----------
NARH_BRASZ      PACVATCPSGAIYKREDGIVLIDQDK-----LCISGCPY-------------KCIFCYPRIESGQPTVCS
YFRA_PROVU      APCANVCPNGAI-IHNKDYYYVDQDKCIGCKTCVLACPYGLTALNTIEAFANKCDLCHHR---AEGPACV
VHUB_METVO      -ECVPVCPVDAISIEDELAV-IDTEKCIYCSVCAQTCPWNAIYVSKRQKEIKSFTVTEECIG---CEKCV
VORD_PYRHO      --CWKYCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK---------------------
VORD_PYRAB      --CWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK---------------------
FER2_THEAC      -ACVGMCPTDAIWL-DETVIKIHEEKCIECGFCIVGCPTG------------------------------
VORD_PYRFU      --CWKYCPEPAIYIKPDGYVAIDYDYCKGCGICANECPTKAITMIKEEK---------------------
FER_METTE       --CVDECPAAAISLNDDGIATVDESECLDCGSCEDACP--------------------------------
FER1_DESVM      -ECVDVCPVEVYELQDGKAVPVNEEECLGCESCVEVCEAG------------------------------
RNFB_PSEU5      -KCIQACPVDAGAARQMHTVII--SECTGCDLCVEPCP--------------------------------
FER3_DESAF      DECVDVCPVEVYELQDGKAVAVNEDECLGCESCVEVC---------------------------------
FER2_DESNO      -ECVDVCPVEVYELQNGKAVPVNEEECLGCESCIEVCP--------------------------------
MVHB_METFE      --CVPECPVNAITLPKYGSIEIDEEKCIKCGICAQTCPWNSVYISKSSRTIENFTL--------------
VHUB_METJA      -KCASVCPTEAIVVDEE---KKEVRMCIVCGACTVACPTGALKLGKIEKCVEVCPMKTLRLSRGKLP---
Y514_METJA      --CYKECPVDAEKAKVKKSAKIIEDKCVKCEICAQTCPVGAIYVIEGRAEIEDSTIKEKRLKKYELDECI
Y1303_METJA     -ECARNCPNKAIKRNEFGGYYVDRRRCNGCGICANVCPIGI-----------------------------
FER_RICCN       TDCVEVCPVDCFYEEDDFMLVINPDECIDCGVCVPDCPIG------------------------------
RNFB_PSEMY      -KCIQACPVDAGAARQMHTVIV--SECTGCDLCVEPCP--------------------------------
NUOI_RUTMC      --CEAVCPANASEMRDDGTYDIDLFKCIFCGFCEEACPVDAIVETQKERLLEVGSQNEQAINQARL----
MVHB_METTH      --CVPECPVDAITLKVGGVIEIDEDTCIKCGVCAQTCPWNAVYIS-------------------------
VHCB_METVO      --CVSACPTEALQMKEYDRIEFTPSLCDSCGACVEICPQNVLKLNEEYKLKGFCVMC-------------
FER2_METJA      --CITQCPINVIYMDEDYNVVFKEEDCVGCKNCLKACPF-------------------------------
NUOI_VESOH      --CEAVCPANASKMRDDGTYDIDLFKCIFCGFCEEACP--------------------------------
NUOI_POLSJ      AVCPALAITIESEVRDDGSYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_ERYLH      --CEAVCPAQASEPRDDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_THICR      --CEAVCPANASEERDDGTYDIDMFKCIYCGFCEEACP--------------------------------
NUOI_SPHAL      --CEAVCPAQAITIRDDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_ROSDO      --CEAVCPAQAITIRDDGSYDIDMTKCIYCGFCEEACP--------------------------------
FER_BACSC       ASCVEVCPVDCIHEGED-QYYIDPDVCIDCGACEAVCPVSAIY---------------------------
NUOI_RALME      --CEAVCPALASDVRNDGTYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_METPP      AVCPALAITIESEVRDDGSYDIDLTKCIFCGFCEESCP--------------------------------
NUOI_EHRCR      --CEAICPAQAITIRDDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_EHRCJ      --CEAICPAQAITIRDDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_DINSH      --CEAICPAQAITIRDDGSYDIDMTKCIYCGFCQEACP--------------------------------
FER2_RHOCA      TDCVEVCPVDCFY-EGENTLVIHPDECIDCGVCEPECP--------------------------------
Y1684_METTH     CLAARRCPT---HAIDNG---LDLDRCFGCGVCAWSCPSG------------------------------
PORD_METJA      --CYIFCPEGAIQEDENGNFKIDYDYCKGCLICMNECPVNAITKVREEK---------------------
NUOI_NEIMF      --CEAVCPAMAINIREDGTYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_NEIMB      --CEAVCPAMAINIREDGTYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_NEIMA      --CEAVCPAMAINIREDGTYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_NEIG1      --CEAVCPAMAINIREDGTYDIDLTKCIFCGFCEEACP--------------------------------
FER_METTL       AECVNACPMEVFEIQGDKVVVAKEDDCTFCMVCVDVCP--------------------------------
NUOI_RALEJ      AVCPALAITIESDVRADGTYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_COXBU      PACIEAGPREADGSRRTTLYDIDAFKCINCGFCEEACPVDAIVLTPE-----------------------
NUOI_COXBR      PACIEAGPREADGSRRTTLYDIDAFKCINCGFCEEACPVDAIVLTPE-----------------------
NUOI_COXBN      PACIEAGPREADGSRRTTLYDIDAFKCINCGFCEEACPVDAIVLTPE-----------------------
FER_RICTY       TDCVEVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP--------------------------------
FER_ALIAC       -DCVETCPVDAIHEGPD-QYYIDPDLCIDCAACEPVCPVNAIY--QEEFVPE------------------
NUOI_SILST      --CEAVCPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_RHOCA      --CEAICPAQAITIRDDGSYDIDMTKCIYCGYCQEACP--------------------------------
NUOI_PARDP      --CEAVCPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_NOVAD      --CEAVCPAQAITIREDGSYDIDMTKCIFCGFCQEACP--------------------------------
NUOI_CHRVO      --CEAVCPAMAISIREDGTYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_BEII9      ICPAKAITIEAGPRRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_AZOSE      AVCPALAITIESEQRDDGSYDIDLTKCIFCGFCEEACP--------------------------------
NUOI1_RHOS4     --CEAVCPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI1_RHOS1     --CEAVCPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NQO9_PARDE      --CEAVCPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_ARATH     --CEAVCPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
FWDF_METJA      --CADICPVNAIAMGPLGAIDIDKDVCVLCGMCASACPFDAKSIKEDERYQDKCVLCEQ-----------
FER_RICPR       TDCVEVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP--------------------------------
FER_RICBR       TDCVEVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP--------------------------------
NUOI_SILPO      --CEAICPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_JANSC      --CEAICPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI1_RHOPA     --CEAVCPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NDUS8_TOBAC     --CEAICPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_SOLTU     --CEAICPAQAITIREDGSYDIDMTKCIYCGFCQEACP--------------------------------
FER6_METJA      --CVVFCPRRA--IKTYGVAIVDENKCSNCGICARYCP--------------------------------
FER2_RHORU      QDCVEVCPVDCFY-EGENFLVINPDECIDCGVCNPECP--------------------------------
FER1_CAUCR      MDCVEVCPVDCFY-EGENFLVINPDECIDCGVCEPECP--------------------------------
Y208_METJA      ---INVCPNGAI-VKRDNFVEILLSKCLGCGNCKKVCPY-------------------------------
RNFB_SODGM      -KCIQACPVDAIVGATRAVHTVVSDLCTGCDLCVAPCP--------------------------------
NUOI_XANP2      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_RICTY      --CEAVCPAQASDERDDGSYDIDMTKCIYCGLCQEACP--------------------------------
NUOI_RHILW      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_RHILO      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_RHIL3      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_POLNA      AVCPALAITIESDVREDGSYDIDLTKCIFCGFCEESCP--------------------------------
NUOI_PELPD      --CATVCPADPFHPKSPDRFEIDYSRCIFCGFCVEACP--------------------------------
NUOI_OCHA4      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_METSB      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_MESSB      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_HALHL      --CEAVCPALASHQRADGTYDIDMFKCIYCGFCEESCP--------------------------------
NUOI_BRUSU      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUSI      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUO2      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUME      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUMB      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUC2      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUAB      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUA2      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BRUA1      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BART1      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BARHE      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_BARBK      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_AZOC5      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_AGRVS      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_AGRT5      --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI1_RHIME     --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
NUOI1_RHIEC     --CEAICPAQAITIRNDGTYDIDMVKCIYCGFCQEACP--------------------------------
FER_THET8       QSCVEVCPVECIYDGGD-QFYIHPEECIDCGACVPACPVNAIY--PEEDVPEQ-----------------
FER4_METJA      AECVNNCPMEVFEIEGDKVVVARPDDCTYCGVCEDVCPTG------------------------------
FER1_AFIFE      MDCVEVCPVDCFY-EGENMLVIHPDECIDCGVCEPECP--------------------------------
RNFB_AERHH      -KCIQACPVDAIVGATKAMHTVIADECTGCDLCVDPCP--------------------------------
NUOI_RICPR      --CEAICPAQASDERDDGSYDIDMTKCIYCGLCQEACP--------------------------------
NUOI_HERAR      --CEAVCPAMASEQRDDGSYDIDLTKCIFCGFCEESCP--------------------------------
NUOI_DECAR      --CEAICPALAITIRDDGSYDIDLTKCIFCGFCEEACP--------------------------------
NUOI_CHLT3      --CSRVCPTELEQERHPATFEINMLRCIYCGYCEEVCPYDITFNNRENAIMDKSKL--------------
NUOI_ANAPZ      --CEAICPAQAITIRSDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_ACISJ      AVCPAVAITIESDVRADGSYDIDLTKCIFCGFCEESCP--------------------------------
NUOI2_NITMU     AVCPALAITIESEQREDGTYDIDLTKCIFCGFCEESCP--------------------------------
HDRA_METTM      -VCIELCPFGAISI-EEGHANVNVALCKGCGTCVAACPSG------------------------------
HDRA_METTH      -VCIELCPFGAISI-EEGHANVNVALCKGCGTCVAACPSG------------------------------
HDRA_METMA      --CVEVCKFGKISIVDKKAV-VDEVSCYGCGDCSAACPVGAIQMRNFE---NEQILAQVRAATAHKSQC-
FER_RICFE       TDCVDVCPVDCFY-EGEFMLVINPDECIDCGVCVPDCP--------------------------------
Y1043_HAEIN     PDCQTACPLQAI----SSTLEIDNERCNGCGECKITC---------------------------------
PHFL_DESVO      -------------------IQIDESKCIGCDSCQQYCPTG------------------------------
NUOI_RICFE      --CEAICPAQAIVIRDDGSYDIDMTKCIYCGLCQEACP--------------------------------
NUOI_RHORT      --CEAICPAQAITIRTDGSYDIDMTKCIYCGFCEEACP--------------------------------
NUOI_BORA1      AVCPALAITIESDQREDGTYDIDLTKCIFCGFCEESCP--------------------------------
NUOI_ANAMM      --CEAICPAQAITIRGDGSYDIDMTKCIYCGFCQEACP--------------------------------
NUOI_ALHEH      --CEAVCPAEAGPREDDGTYEIDMFKCIYCGFCEESCP--------------------------------
NDUS8_MACFA     --CEAVCPAQAITIRADGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_BOVIN     --CEAVCPAQAITIRADGSYDIDMTKCIYCGFCQEACP--------------------------------
FER_CLOTS       --CAAECPVEAIH-EGTGKYEVDADTCIDCGACEAVCPTG------------------------------
FER_CHRVI       -------------------------ECINCDVCEPECPNGAISQGDETYVIEP-SLCTECVGHYETSQCV
Y51B_METJA      --CERACPINVIE-RKEGKYVINMALCISCKECIKVCP--------------------------------
RNFB_THIDA      --CIQACPVDAISGAAKQMHTIIADECTGCELCLAPCP--------------------------------
PORD_METBF      -----VCPDMSVKPRENGFFEYDYDYCKGCGICANECPADAIEMILEEK---------------------
NUOI_MAGSA      --CEAICPAQAITIRDDGSYDLDMTKCIYCGLCQEACP--------------------------------
NUOI_HYPNA      --CEAICPAQAITIREDGAYDIDMVKCIYCGFCQEACP--------------------------------
NUOI_AZOSB      --CEAICPAMASEQREDGSYDIDLTKCIFCGFCEEACP--------------------------------
NDUS8_RECAM     --CEAICPAQASEPRIDGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_PONAB     --CEAICPAQAITIRADGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_PANTR     --CEAICPAQAITIRADGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_MOUSE     --CEAICPAQAITIRADGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_HUMAN     --CEAICPAQAITIRADGSYDIDMTKCIYCGFCQEACP--------------------------------
NDUS8_GORGO     --CEAICPAQAITIRADGSYDIDMTKCIYCGFCQEACP--------------------------------
HDRA_METAC      --CVEVCKFGKISIENKKAV-VDEVSCYGCGDCSAACPVGAIQMRNFENEQILAQVREATAHKSQCPFIV
GLUS_METJA      -----------SYVPPKYKVEVDPNRCMLCERCTIECSWGV-YRREGDRIISYSNRC------GACHRCV
Y870_METJA      --CAEVCKVEAIDIRGE-TSYTNYNVCVGCGKCIKNCPNEAREVKEEGYLV-------------------
RNFB_YERPN      -KCIQACPVDAIIGATRAMHTVLSDLCTGCDLCVAPCP--------------------------------
RNFB_YERPG      -KCIQACPVDAIIGATRAMHTVLSDLCTGCDLCVAPCP--------------------------------
RNFB_YERPE      -KCIQACPVDAIIGATRAMHTVLSDLCTGCDLCVAPCP--------------------------------
RNFB_YERPA      -KCIQACPVDAIIGATRAMHTVLSDLCTGCDLCVAPCP--------------------------------
RNFB_BUCBP      -------------------VEIDENNCVGCSKCRLVCPVDATYNFRHTVLIDSCTGCNLCI-----PLCP
RNFB_AERS4      -KCIQACPVDAIVGATKAMHTVITDECTGCDLCVDPCP--------------------------------
NUOI_VEREI      AVCPALAITIESELRADGSYDIDLTKCIFCGFCEESCP--------------------------------
NUOI_RHOFD      --CEAICPAMASEVRADGSYDIDLNKCIFCGFCEESCP--------------------------------
NUOI_MARMM      --CEAICPAQAITIRSDGSYDIDMTKCIYCGYCQEACP--------------------------------
NUOI_ACIAC      AVCPALAITIESDVRADGSYDIDLTKCIFCGFCEESCP--------------------------------
IORA_ARCFU      -ECVNTCP---ALIFDGEKVSIDQSLCVGCAVCAKICP--------------------------------


                         +         .         .         .         .         *         .:210
query           AQCGARARFFGDLDQGVDNFEGPAHPDSPGCQYEEMTQTRVKLKDYVEPYTENDIHHLADVGNEPKxxxx
PHSB_SALTY      SVCPTDALKFGRLDE-------------------------------------------------------
PHSB_SALTI      SVCPTDALKFGRLDE-------------------------------------------------------
NRFC_HAEIN      EACPTKALTFGDMND-------PTSAVSRKVKEKPVYRTKVELG------TQPNLYHIPFQHGEPR----
DMSB_ECOLI      ESCPLRALDFGPIDE-------------------------------------------------------
YNFG_ECOLI      ESCPLRALEFGPIEE-------------------------------------------------------
YNFG_ECOL6      ESCPLRALEFGPIEE-------------------------------------------------------
DMSB_SHIFL      ESCPLRALDFGPIDE-------------------------------------------------------
NRFC_SHIFL      EACPTKALTFGNLD--------------------------------------------------------
NRFC_ECOLI      EACPTKALTFGNLD--------------------------------------------------------
NRFC_ECO57      EACPTKALTFGNLD--------------------------------------------------------
YDHX_ECOLI      SACPEHALIFGRED--------------------------------------------------------
YDHX_ECO57      SACPEHALIFGRED--------------------------------------------------------
PSRB_WOLSU      TVCPTDALTFGDM---------------------------------------------------------
SERB_THASE      KQCSGRIRFWGYRD------------DKDGPIYKLVDQWKVALPLHAEYGTEPNVFYVPPMNTTP-----
CLRB_IDEDE      KQCSGRIRFWGYRD------------DKNGPIYKLVEQWKVALPLHAEYGTEPNVFYVPPMNTTP-----
DMSB_HAEIN      DACPLRALDFAPIDE-------------------------------------------------------
HMEA_ARCFU      EACGKGALVFGNI---------------------------------------------------------
HMC2_DESVH      EICPKEALTFG-----------------------------------------------------------
FDNH_SHIFL      KTCPTGAIHFG-----------------------------------------------------------
FDNH_ECOLI      KTCPTGAIHFG-----------------------------------------------------------
FDOH_SHIFL      KTCPTGAIHFG-----------------------------------------------------------
FDOH_ECOLI      KTCPTGAIHFG-----------------------------------------------------------
FDOH_ECOL6      KTCPTGAIHFG-----------------------------------------------------------
DDHB_RHOSU      KQCVGRIRFIGYLDDEA----GPVH---------------------------------------------
FDXH_HAEIN      KTCPTGAIRFGSKEE-------------------------------------------------------
FDHB_WOLSU      AMCSTKALLAGDSD--------------------------------------------------------
NARY_ECOLI      ETCVGRIRYLGVLLYDADRIEEAASTEREVDLYERQCE--------------------------------
HYBA_SHIFL      EVCPAGAVIFGTREE-------------------------------------------------------
HYBA_ECOLI      EVCPAGAVIFGTREE-------------------------------------------------------
HYBA_ECO57      EVCPAGAVIFGTREE-------------------------------------------------------
YGFT_ECOLI      EVCPTQALRLMD-DKGLQQIK-------------------------------------------------
NARH_BACSU      ETCVGRIRYLGVMLYDADKVEEAA----------------------------------------------
NARH_SHIFL      ETCVGRIRYLGVLLYDADAIERAASTENEKDLYQ------------------------------------
NARH_ECOLI      ETCVGRIRYLGVLLYDADAIERAASTENEKDLYQ------------------------------------
PGTS_PELAC      HNCGS-----------------------------------------------------------------
FER8_METJA      EACKDKA---------------------------------------------------------------
COOF_RHORU      EACPTKAIRMVDLD--------------------------------------------------------
HYDN_ECOLI      AACPTHA---------------------------------------------------------------
HYDN_ECOL6      AACPTHA---------------------------------------------------------------
HYDN_ECO57      AACPTHA---------------------------------------------------------------
YDHY_SHIFL      ----------------------------------------------------------------------
YDHY_ECOLI      ----------------------------------------------------------------------
YDHY_ECO57      ----------------------------------------------------------------------
YGFS_ECOLI      ESCPTQA---------------------------------------------------------------
FER9_METJA      KACSKRCLELVDVNE-------------------------------------------------------
HYFA_ECOLI      ----------------------------------------------------------------------
YSAA_ECOLI      EACPTKA---------------------------------------------------------------
FDHB_DESGI      TSCPTGAMNFGDLSE-------------------------------------------------------
AEGA_ECOLI      ENCPADA---------------------------------------------------------------
HYCB_SHIFL      ----------------------------------------------------------------------
HYCB_ECOLI      ----------------------------------------------------------------------
HYCB_ECOL6      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
NARH_BRASZ      ETC--VGRYLGVLLYDADRIEEAA----------------------------------------------
YFRA_PROVU      EVCPTQALVCIDRD--------------------------------------------------------
VHUB_METVO      EVC-------------------------------------------------------------------
VORD_PYRHO      ----------------------------------------------------------------------
VORD_PYRAB      ----------------------------------------------------------------------
FER2_THEAC      ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
FER_METTE       ----------------------------------------------------------------------
FER1_DESVM      ----------------------------------------------------------------------
RNFB_PSEU5      ----------------------------------------------------------------------
FER3_DESAF      ----------------------------------------------------------------------
FER2_DESNO      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
Y514_METJA      -KCGICARF-------------------------------------------------------------
Y1303_METJA     ----------------------------------------------------------------------
FER_RICCN       ----------------------------------------------------------------------
RNFB_PSEMY      ----------------------------------------------------------------------
NUOI_RUTMC      ----------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
NUOI_VESOH      ----------------------------------------------------------------------
NUOI_POLSJ      ----------------------------------------------------------------------
NUOI_ERYLH      ----------------------------------------------------------------------
NUOI_THICR      ----------------------------------------------------------------------
NUOI_SPHAL      ----------------------------------------------------------------------
NUOI_ROSDO      ----------------------------------------------------------------------
FER_BACSC       ----------------------------------------------------------------------
NUOI_RALME      ----------------------------------------------------------------------
NUOI_METPP      ----------------------------------------------------------------------
NUOI_EHRCR      ----------------------------------------------------------------------
NUOI_EHRCJ      ----------------------------------------------------------------------
NUOI_DINSH      ----------------------------------------------------------------------
FER2_RHOCA      ----------------------------------------------------------------------
Y1684_METTH     ----------------------------------------------------------------------
PORD_METJA      ----------------------------------------------------------------------
NUOI_NEIMF      ----------------------------------------------------------------------
NUOI_NEIMB      ----------------------------------------------------------------------
NUOI_NEIMA      ----------------------------------------------------------------------
NUOI_NEIG1      ----------------------------------------------------------------------
FER_METTL       ----------------------------------------------------------------------
NUOI_RALEJ      ----------------------------------------------------------------------
NUOI_COXBU      ----------------------------------------------------------------------
NUOI_COXBR      ----------------------------------------------------------------------
NUOI_COXBN      ----------------------------------------------------------------------
FER_RICTY       ----------------------------------------------------------------------
FER_ALIAC       ----------------------------------------------------------------------
NUOI_SILST      ----------------------------------------------------------------------
NUOI_RHOCA      ----------------------------------------------------------------------
NUOI_PARDP      ----------------------------------------------------------------------
NUOI_NOVAD      ----------------------------------------------------------------------
NUOI_CHRVO      ----------------------------------------------------------------------
NUOI_BEII9      ----------------------------------------------------------------------
NUOI_AZOSE      ----------------------------------------------------------------------
NUOI1_RHOS4     ----------------------------------------------------------------------
NUOI1_RHOS1     ----------------------------------------------------------------------
NQO9_PARDE      ----------------------------------------------------------------------
NDUS8_ARATH     ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
FER_RICPR       ----------------------------------------------------------------------
FER_RICBR       ----------------------------------------------------------------------
NUOI_SILPO      ----------------------------------------------------------------------
NUOI_JANSC      ----------------------------------------------------------------------
NUOI1_RHOPA     ----------------------------------------------------------------------
NDUS8_TOBAC     ----------------------------------------------------------------------
NDUS8_SOLTU     ----------------------------------------------------------------------
FER6_METJA      ----------------------------------------------------------------------
FER2_RHORU      ----------------------------------------------------------------------
FER1_CAUCR      ----------------------------------------------------------------------
Y208_METJA      ----------------------------------------------------------------------
RNFB_SODGM      ----------------------------------------------------------------------
NUOI_XANP2      ----------------------------------------------------------------------
NUOI_RICTY      ----------------------------------------------------------------------
NUOI_RHILW      ----------------------------------------------------------------------
NUOI_RHILO      ----------------------------------------------------------------------
NUOI_RHIL3      ----------------------------------------------------------------------
NUOI_POLNA      ----------------------------------------------------------------------
NUOI_PELPD      ----------------------------------------------------------------------
NUOI_OCHA4      ----------------------------------------------------------------------
NUOI_METSB      ----------------------------------------------------------------------
NUOI_MESSB      ----------------------------------------------------------------------
NUOI_HALHL      ----------------------------------------------------------------------
NUOI_BRUSU      ----------------------------------------------------------------------
NUOI_BRUSI      ----------------------------------------------------------------------
NUOI_BRUO2      ----------------------------------------------------------------------
NUOI_BRUME      ----------------------------------------------------------------------
NUOI_BRUMB      ----------------------------------------------------------------------
NUOI_BRUC2      ----------------------------------------------------------------------
NUOI_BRUAB      ----------------------------------------------------------------------
NUOI_BRUA2      ----------------------------------------------------------------------
NUOI_BRUA1      ----------------------------------------------------------------------
NUOI_BART1      ----------------------------------------------------------------------
NUOI_BARHE      ----------------------------------------------------------------------
NUOI_BARBK      ----------------------------------------------------------------------
NUOI_AZOC5      ----------------------------------------------------------------------
NUOI_AGRVS      ----------------------------------------------------------------------
NUOI_AGRT5      ----------------------------------------------------------------------
NUOI1_RHIME     ----------------------------------------------------------------------
NUOI1_RHIEC     ----------------------------------------------------------------------
FER_THET8       ----------------------------------------------------------------------
FER4_METJA      ----------------------------------------------------------------------
FER1_AFIFE      ----------------------------------------------------------------------
RNFB_AERHH      ----------------------------------------------------------------------
NUOI_RICPR      ----------------------------------------------------------------------
NUOI_HERAR      ----------------------------------------------------------------------
NUOI_DECAR      ----------------------------------------------------------------------
NUOI_CHLT3      ----------------------------------------------------------------------
NUOI_ANAPZ      ----------------------------------------------------------------------
NUOI_ACISJ      ----------------------------------------------------------------------
NUOI2_NITMU     ----------------------------------------------------------------------
HDRA_METTM      ----------------------------------------------------------------------
HDRA_METTH      ----------------------------------------------------------------------
HDRA_METMA      ----------------------------------------------------------------------
FER_RICFE       ----------------------------------------------------------------------
Y1043_HAEIN     ----------------------------------------------------------------------
PHFL_DESVO      ----------------------------------------------------------------------
NUOI_RICFE      ----------------------------------------------------------------------
NUOI_RHORT      ----------------------------------------------------------------------
NUOI_BORA1      ----------------------------------------------------------------------
NUOI_ANAMM      ----------------------------------------------------------------------
NUOI_ALHEH      ----------------------------------------------------------------------
NDUS8_MACFA     ----------------------------------------------------------------------
NDUS8_BOVIN     ----------------------------------------------------------------------
FER_CLOTS       ----------------------------------------------------------------------
FER_CHRVI       EVC-------------------------------------------------------------------
Y51B_METJA      ----------------------------------------------------------------------
RNFB_THIDA      ----------------------------------------------------------------------
PORD_METBF      ----------------------------------------------------------------------
NUOI_MAGSA      ----------------------------------------------------------------------
NUOI_HYPNA      ----------------------------------------------------------------------
NUOI_AZOSB      ----------------------------------------------------------------------
NDUS8_RECAM     ----------------------------------------------------------------------
NDUS8_PONAB     ----------------------------------------------------------------------
NDUS8_PANTR     ----------------------------------------------------------------------
NDUS8_MOUSE     ----------------------------------------------------------------------
NDUS8_HUMAN     ----------------------------------------------------------------------
NDUS8_GORGO     ----------------------------------------------------------------------
HDRA_METAC      A---------------------------------------------------------------------
GLUS_METJA      VMC-------------------------------------------------------------------
Y870_METJA      ----------------------------------------------------------------------
RNFB_YERPN      ----------------------------------------------------------------------
RNFB_YERPG      ----------------------------------------------------------------------
RNFB_YERPE      ----------------------------------------------------------------------
RNFB_YERPA      ----------------------------------------------------------------------
RNFB_BUCBP      TNC-------------------------------------------------------------------
RNFB_AERS4      ----------------------------------------------------------------------
NUOI_VEREI      ----------------------------------------------------------------------
NUOI_RHOFD      ----------------------------------------------------------------------
NUOI_MARMM      ----------------------------------------------------------------------
NUOI_ACIAC      ----------------------------------------------------------------------
IORA_ARCFU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxx
PHSB_SALTY      ---------
PHSB_SALTI      ---------
NRFC_HAEIN      ---------
DMSB_ECOLI      ---------
YNFG_ECOLI      ---------
YNFG_ECOL6      ---------
DMSB_SHIFL      ---------
NRFC_SHIFL      ---------
NRFC_ECOLI      ---------
NRFC_ECO57      ---------
YDHX_ECOLI      ---------
YDHX_ECO57      ---------
PSRB_WOLSU      ---------
SERB_THASE      ---------
CLRB_IDEDE      ---------
DMSB_HAEIN      ---------
HMEA_ARCFU      ---------
HMC2_DESVH      ---------
FDNH_SHIFL      ---------
FDNH_ECOLI      ---------
FDOH_SHIFL      ---------
FDOH_ECOLI      ---------
FDOH_ECOL6      ---------
DDHB_RHOSU      ---------
FDXH_HAEIN      ---------
FDHB_WOLSU      ---------
NARY_ECOLI      ---------
HYBA_SHIFL      ---------
HYBA_ECOLI      ---------
HYBA_ECO57      ---------
YGFT_ECOLI      ---------
NARH_BACSU      ---------
NARH_SHIFL      ---------
NARH_ECOLI      ---------
PGTS_PELAC      ---------
FER8_METJA      ---------
COOF_RHORU      ---------
HYDN_ECOLI      ---------
HYDN_ECOL6      ---------
HYDN_ECO57      ---------
YDHY_SHIFL      ---------
YDHY_ECOLI      ---------
YDHY_ECO57      ---------
YGFS_ECOLI      ---------
FER9_METJA      ---------
HYFA_ECOLI      ---------
YSAA_ECOLI      ---------
FDHB_DESGI      ---------
AEGA_ECOLI      ---------
HYCB_SHIFL      ---------
HYCB_ECOLI      ---------
HYCB_ECOL6      ---------
Y264_METJA      ---------
NARH_BRASZ      ---------
YFRA_PROVU      ---------
VHUB_METVO      ---------
VORD_PYRHO      ---------
VORD_PYRAB      ---------
FER2_THEAC      ---------
VORD_PYRFU      ---------
FER_METTE       ---------
FER1_DESVM      ---------
RNFB_PSEU5      ---------
FER3_DESAF      ---------
FER2_DESNO      ---------
MVHB_METFE      ---------
VHUB_METJA      ---------
Y514_METJA      ---------
Y1303_METJA     ---------
FER_RICCN       ---------
RNFB_PSEMY      ---------
NUOI_RUTMC      ---------
MVHB_METTH      ---------
VHCB_METVO      ---------
FER2_METJA      ---------
NUOI_VESOH      ---------
NUOI_POLSJ      ---------
NUOI_ERYLH      ---------
NUOI_THICR      ---------
NUOI_SPHAL      ---------
NUOI_ROSDO      ---------
FER_BACSC       ---------
NUOI_RALME      ---------
NUOI_METPP      ---------
NUOI_EHRCR      ---------
NUOI_EHRCJ      ---------
NUOI_DINSH      ---------
FER2_RHOCA      ---------
Y1684_METTH     ---------
PORD_METJA      ---------
NUOI_NEIMF      ---------
NUOI_NEIMB      ---------
NUOI_NEIMA      ---------
NUOI_NEIG1      ---------
FER_METTL       ---------
NUOI_RALEJ      ---------
NUOI_COXBU      ---------
NUOI_COXBR      ---------
NUOI_COXBN      ---------
FER_RICTY       ---------
FER_ALIAC       ---------
NUOI_SILST      ---------
NUOI_RHOCA      ---------
NUOI_PARDP      ---------
NUOI_NOVAD      ---------
NUOI_CHRVO      ---------
NUOI_BEII9      ---------
NUOI_AZOSE      ---------
NUOI1_RHOS4     ---------
NUOI1_RHOS1     ---------
NQO9_PARDE      ---------
NDUS8_ARATH     ---------
FWDF_METJA      ---------
FER_RICPR       ---------
FER_RICBR       ---------
NUOI_SILPO      ---------
NUOI_JANSC      ---------
NUOI1_RHOPA     ---------
NDUS8_TOBAC     ---------
NDUS8_SOLTU     ---------
FER6_METJA      ---------
FER2_RHORU      ---------
FER1_CAUCR      ---------
Y208_METJA      ---------
RNFB_SODGM      ---------
NUOI_XANP2      ---------
NUOI_RICTY      ---------
NUOI_RHILW      ---------
NUOI_RHILO      ---------
NUOI_RHIL3      ---------
NUOI_POLNA      ---------
NUOI_PELPD      ---------
NUOI_OCHA4      ---------
NUOI_METSB      ---------
NUOI_MESSB      ---------
NUOI_HALHL      ---------
NUOI_BRUSU      ---------
NUOI_BRUSI      ---------
NUOI_BRUO2      ---------
NUOI_BRUME      ---------
NUOI_BRUMB      ---------
NUOI_BRUC2      ---------
NUOI_BRUAB      ---------
NUOI_BRUA2      ---------
NUOI_BRUA1      ---------
NUOI_BART1      ---------
NUOI_BARHE      ---------
NUOI_BARBK      ---------
NUOI_AZOC5      ---------
NUOI_AGRVS      ---------
NUOI_AGRT5      ---------
NUOI1_RHIME     ---------
NUOI1_RHIEC     ---------
FER_THET8       ---------
FER4_METJA      ---------
FER1_AFIFE      ---------
RNFB_AERHH      ---------
NUOI_RICPR      ---------
NUOI_HERAR      ---------
NUOI_DECAR      ---------
NUOI_CHLT3      ---------
NUOI_ANAPZ      ---------
NUOI_ACISJ      ---------
NUOI2_NITMU     ---------
HDRA_METTM      ---------
HDRA_METTH      ---------
HDRA_METMA      ---------
FER_RICFE       ---------
Y1043_HAEIN     ---------
PHFL_DESVO      ---------
NUOI_RICFE      ---------
NUOI_RHORT      ---------
NUOI_BORA1      ---------
NUOI_ANAMM      ---------
NUOI_ALHEH      ---------
NDUS8_MACFA     ---------
NDUS8_BOVIN     ---------
FER_CLOTS       ---------
FER_CHRVI       ---------
Y51B_METJA      ---------
RNFB_THIDA      ---------
PORD_METBF      ---------
NUOI_MAGSA      ---------
NUOI_HYPNA      ---------
NUOI_AZOSB      ---------
NDUS8_RECAM     ---------
NDUS8_PONAB     ---------
NDUS8_PANTR     ---------
NDUS8_MOUSE     ---------
NDUS8_HUMAN     ---------
NDUS8_GORGO     ---------
HDRA_METAC      ---------
GLUS_METJA      ---------
Y870_METJA      ---------
RNFB_YERPN      ---------
RNFB_YERPG      ---------
RNFB_YERPE      ---------
RNFB_YERPA      ---------
RNFB_BUCBP      ---------
RNFB_AERS4      ---------
NUOI_VEREI      ---------
NUOI_RHOFD      ---------
NUOI_MARMM      ---------
NUOI_ACIAC      ---------
IORA_ARCFU      ---------