[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV54068.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "2acjD.bssp"
#ERROR : Can't open dsspfile "2acjA.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "2acjB.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "2d1hB.bssp"

## Summary of PDB Search
:158
    4e-06  15%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    6e-06  15%  2acjD  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    3e-05  12%  2acjA  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    7e-05  16%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    9e-05  25%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    1e-04  15%  2acjB  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    1e-04  20%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-04  11%  2d1hB  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
:158

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPA
2acjC           ------------KFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA----
2acjD           -----------LKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA----
2acjA           ----------------EQRILKFTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA----
1bibA           -----------LKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIQL
1biaA           -----------LKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVP-GKGYSL-----
2acjB           -------------FLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA----
2b0lA           -----------HIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIKVLNN
2d1hB           --CYKITDTDVAVLLKVEIEKP-ITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPKYYYSISSNIL


                         .         .         *         .         .         .         .:140
query           DTNVLEIMEALDDDAKQSTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2acjC           ----------------------------------------------------------------------
2acjD           ----------------------------------------------------------------------
2acjA           ----------------------------------------------------------------------
1bibA           LNAKQILG--------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
2acjB           ----------------------------------------------------------------------
2b0lA           K---------------------------------------------------------------------
2d1hB           E-KIRNDLLNCAKRELAAT---------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxx
2acjC           ------------------
2acjD           ------------------
2acjA           ------------------
1bibA           ------------------
1biaA           ------------------
2acjB           ------------------
2b0lA           ------------------
2d1hB           ------------------