[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV54358.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d4cB.bssp"
#ERROR : Can't open dsspfile "1e39A.bssp"
#ERROR : Can't open dsspfile "2b7sA.bssp"
#ERROR : Can't open dsspfile "2b7rA.bssp"
#ERROR : Can't open dsspfile "1d4cA.bssp"
#ERROR : Can't open dsspfile "1d4cC.bssp"
#ERROR : Can't open dsspfile "1cf3A.bssp"
#ERROR : Can't open dsspfile "1d4dA.bssp"
#ERROR : Can't open dsspfile "3c4nA.bssp"
#ERROR : Can't open dsspfile "3djeA.bssp"
#ERROR : Can't open dsspfile "3djeB.bssp"
#ERROR : Can't open dsspfile "2bs2A.bssp"
#ERROR : Can't open dsspfile "2dkiA.bssp"
#ERROR : Can't open dsspfile "1b3mA.bssp"
#ERROR : Can't open dsspfile "2dkhA.bssp"
#ERROR : Can't open dsspfile "2c76A.bssp"
#ERROR : Can't open dsspfile "3cesC.bssp"
#ERROR : Can't open dsspfile "2c72A.bssp"
#ERROR : Can't open dsspfile "3bhfA.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "3cp8D.bssp"
#ERROR : Can't open dsspfile "3blyA.bssp"
#ERROR : Can't open dsspfile "3cesA.bssp"
#ERROR : Can't open dsspfile "3bhkA.bssp"
#ERROR : Can't open dsspfile "1cc6A.bssp"
#ERROR : Can't open dsspfile "2bxsA.bssp"
#ERROR : Can't open dsspfile "3dmeA.bssp"
#ERROR : Can't open dsspfile "2dpoA.bssp"
#ERROR : Can't open dsspfile "1cc4A.bssp"
#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "2c75B.bssp"
#ERROR : Can't open dsspfile "2bxrA.bssp"
#ERROR : Can't open dsspfile "3cp2A.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "2bk4B.bssp"
#ERROR : Can't open dsspfile "1e6eC.bssp"
#ERROR : Can't open dsspfile "1bgjA.bssp"
#ERROR : Can't open dsspfile "1b37A.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "1cjcA.bssp"
#ERROR : Can't open dsspfile "3cesB.bssp"
#ERROR : Can't open dsspfile "3b3rA.bssp"
#ERROR : Can't open dsspfile "2culA.bssp"
#ERROR : Can't open dsspfile "1d7lA.bssp"
#ERROR : Can't open dsspfile "1b8sA.bssp"
#ERROR : Can't open dsspfile "3djdA.bssp"
#ERROR : Can't open dsspfile "1d5tA.bssp"
#ERROR : Can't open dsspfile "1bf3A.bssp"
#ERROR : Can't open dsspfile "3d4oC.bssp"
#ERROR : Can't open dsspfile "3cgvA.bssp"
#ERROR : Can't open dsspfile "3cesD.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "3djdB.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"
#ERROR : Can't open dsspfile "1cj4A.bssp"
#ERROR : Can't open dsspfile "3coxA.bssp"
#ERROR : Can't open dsspfile "2cyjA.bssp"
#ERROR : Can't open dsspfile "1bgnA.bssp"
#ERROR : Can't open dsspfile "1e0dA.bssp"
#ERROR : Can't open dsspfile "2c73B.bssp"
#ERROR : Can't open dsspfile "2c73A.bssp"
#ERROR : Can't open dsspfile "2brxA.bssp"
#ERROR : Can't open dsspfile "3cp8A.bssp"
#ERROR : Can't open dsspfile "2drvA.bssp"
#ERROR : Can't open dsspfile "3bi4B.bssp"
#ERROR : Can't open dsspfile "3cirM.bssp"
#ERROR : Can't open dsspfile "3c96A.bssp"
#ERROR : Can't open dsspfile "1b73A.bssp"

## Summary of PDB Search
:589
    1e-29  22%  1d4cB  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    3e-28  20%  1e39A  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    4e-23  20%  2b7sA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    6e-22  20%  2b7rA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    8e-20  19%  1d4cA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    7e-16  21%  1d4cC  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    4e-15  10%  1cf3A  [c.3.1 - d.16.1] PROTEIN (GLUCOSE OXIDASE)
    8e-15  21%  1d4dA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    1e-08   9%  3c4nA  [x.x.x] UNCHARACTERIZED PROTEIN DR_0571
    4e-08  12%  3djeA  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    5e-08  11%  3djeB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    1e-07  16%  2bs2A  [c.3.1 - d.168.1 - a.7.3 (1e7pA)] QUINOL-FUMARATE REDUCTASE
    1e-07  10%  2dkiA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    2e-07  15%  1b3mA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    5e-07   9%  2dkhA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    6e-07  11%  2c76A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    6e-07  22%  3cesC  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-06  10%  2c72A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    4e-06  11%  3bhfA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    4e-06  13%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1[MASQUE : MEMB(X) 44 / COIL(x)
    1e-05  19%  3cp8D  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    1e-05   7%  3blyA  [x.x.x] PYRANOSE OXIDASE
    1e-05  16%  3cesA  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    1e-05  15%  3bhkA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    1e-05  11%  1cc6A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    1e-05  33%  2bxsA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    2e-05  16%  3dmeA  [x.x.x] CONSERVED EXPORTED PROTEIN
    2e-05  23%  2dpoA  [x.x.x] L-GULONATE 3-DEHYDROGENASE
    2e-05  13%  1cc4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    3e-05  24%  1bhyA  [x.x.x] P64K
    4e-05  12%  2c75B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-05  29%  2bxrA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    7e-05  16%  3cp2A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    7e-05  12%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    7e-05  13%  2bk4B  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] B
    9e-05  16%  1e6eC  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    1e-04   9%  1bgjA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-04  27%  1b37A  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    1e-04   8%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    1e-04  15%  1cjcA  [c.4.1 - c.3.1] PROTEIN (ADRENODOXIN REDUCTASE)
    2e-04  16%  3cesB  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-04  10%  3b3rA  [x.x.x] CHOLESTEROL OXIDASE
    2e-04  32%  2culA  [x.x.x] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED
    2e-04  12%  1d7lA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    2e-04  13%  1b8sA  [c.3.1 - d.16.1] PROTEIN (CHOLESTEROL OXIDASE)
    2e-04  12%  3djdA  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    2e-04  18%  1d5tA  [c.3.1 - d.16.1] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR
    2e-04  11%  1bf3A  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-04  13%  3d4oC  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    3e-04  10%  3cgvA  [x.x.x] GERANYLGERANYL REDUCTASE RELATED PROTEIN
    3e-04  11%  3cesD  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    3e-04  17%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    4e-04  11%  3djdB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    4e-04  14%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    4e-04  11%  1cj4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    4e-04  24%  3coxA  [x.x.x] CHOLESTEROL OXIDASE
    4e-04  10%  2cyjA  [x.x.x] HYPOTHETICAL PROTEIN PH1505
    4e-04   9%  1bgnA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    4e-04   9%  1e0dA  [c.5.1 - c.72.2 - c.59.1]
    4e-04  22%  2c73B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-04  25%  2c73A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-04  14%  2brxA  [x.x.x] URIDYLATE KINASE
    5e-04  21%  3cp8A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    5e-04  10%  2drvA  [x.x.x] UPF0130 PROTEIN PH1069
    6e-04  21%  3bi4B  [x.x.x] POLYAMINE OXIDASE FMS1
    7e-04  13%  3cirM  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    7e-04  38%  3c96A  [x.x.x] FLAVIN-CONTAINING MONOOXYGENASE
    0.001  13%  1b73A  [c.78.2 - c.78.2] GLUTAMATE RACEMASE
:589

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAFE
1d4cB           ----------------------------------------------------------------------
1e39A           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
2b7rA           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1cf3A           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
3djeA           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
2dkiA           -------------------------------------------------------------------ASP
1b3mA           ----------------------------------------------------------------------
2dkhA           -------------------------------------------------------------------ASP
2c76A           ----------------------------------------------------------------------
3cesC           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
3cp8D           ----------------------------------------------------------------------
3blyA           ----------------------------------------------------------------------
3cesA           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3dmeA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
3cp2A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1e6eC           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
3cesB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
3cesD           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKFHERLG
1d4cB           ---------------TTDVVIIGSGGAGLAAAVSARDAGAKVILL--EKEPIPGGNTAAGGMNAAETKPQ
1e39A           -----------------DVVVVGSGGAGFSAAISATDSGAKVILI-----------------EKEPVIGG
2b7sA           --------------DTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQ
2b7rA           --------------DTVDVVVVGSGGAGFSAAISATDSGAKVILI----EKEPVIGGNAKLAAGGMNAAW
1d4cA           ---------------TTDVVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGNTKLAAGGMNAAETKPQ
1d4cC           ---------------TTDVVIIGSGGAGLAAAVSARDAGAKVILL--EKEPIPGGNTAAGGMNAAETKPQ
1cf3A           --------------------RSGNGLGGSTLVNGGTWTRPHKAQV----DSWETVFGNEGWNLQAERARA
1d4dA           ---------------TTDVVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGNTKLAAGGMNAAETKPQ
3c4nA           --------------EAFDIVVIGAGRGAACAFYLRQLAPGRSLLLVEEGGLPNEEGATILAPGVWT----
3djeA           -----------AVTKSSSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVPSAISAGNDVNKVISSGQY
3djeB           ---------------SSSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVPSAISAGNDVNKVISYSNN
2bs2A           ------------KVQYCDSLVIGGGLAGLRAAVATQQKGLSTIVL--SLIPVKRSHS-AAAQGGMQASLG
2dkiA           LAPAHTE----AVPSQVDVLIVGCGPAGLTLAAQLAAFPDIRTCIVEQKEGPMELGQADGIACRTMEMFE
1b3mA           ---------------HFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGE
2dkhA           LAPAHTEAVPS----QVDVLIVGCGPAGLTLAAQLAAFPDIRTCIVEQKEGPMELGQADGIACRTMEMFE
2c76A           ---------------KCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGG
3cesC           -----------------DVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQNPAIGGIG--------
2c72A           ---------------KCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGG
3bhfA           ---------------HFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTKIIRHAYGE
2cfyA           -----------VLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKEETVKHDWD
3cp8D           -----------------DVIVVGAGHAGCEAALAVARGGLHCLLITSDLSAVARMSCNPAIGGVAKGQIT
3blyA           ----------------------------------------------------------------------
3cesA           ----PRGSHMF-YPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNIGKGHLVKEVDA
3bhkA           ---------------HFDVIVVGAGSMGMAAGYQLAKQGVKTLLV--DAFDPPHTNGSHTKIIRHAYGEG
1cc6A           ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVIL-ERQTPDYVLGRIRAGVLEQGMVDL
2bxsA           -----------------DVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIR-----------
3dmeA           -----------------DCIVIGAGVVGLAIARALAAGGHEVLVAEAAE-GIGTGTSNSEVIHAGIYYPA
2dpoA           ----------------GDVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGA---------------
1cc4A           ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLL
1bhyA           -----------SADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKA-----
2c75B           ---------------KCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGG
2bxrA           -----------------DVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDY-----
3cp2A           ------------YPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNIGKGHLVKEVDA
3cukA           -----------------RVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYRFTPLTTTDVAAGLWQPYL
2bk4B           ---------------KCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGG
1e6eC           -----------------QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKN
1bgjA           ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLL
1b37A           ------------------VIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVE---
2e4gA           ---------------IDKILIVGGGTAGWMAASYLGKALQGTTLLQAPDIPTLGVGEATIPNLQTAFFDF
1cjcA           -----------------QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKN
3cesB           ------------YPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNIGKGHLVKEVDA
3b3rA           -----------DNGGYVPAVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKR
2culA           -----------------QVLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDA-------------------
1d7lA           ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLL
1b8sA           ---------------YVPAVVIGTGYGAAVSALRLGEAGVQTLMLEM-GQLWNQPGPDGNIFCGMLNPDK
3djdA           ---------------SSSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVPSAISAGNDVNKVISSEVN
1d5tA           ---------------EYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYK----
1bf3A           ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGKIRAGVLEMVDLLRE
3d4oC           -----------------HVVIIGGDARQLEIIRKLSTFDAKISLVGFDQLDDGFIGVTKRID--------
3cgvA           -------------GETYDVLVVGGGPGGSTAARYAAKYGLKTLIEKRPEIGSPVRCGEGLSKGILNEADI
3cesD           ------------YPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDT---LGQMSCNPAIGGIGKG
3dghB           -------------SYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCI
3djdB           ---------------SSSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVPSAISAGNDVNKVISSIEV
2aejB           ------------------VVICGWSESTLECLRELRGSEVFVLAEDENVRKKVL----------------
1cj4A           ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVILERTTPDLGRIRAGVLEQGMVDLLRE
3coxA           -----------ADGDRVPALVIGSGYGGAVAALRLTQAGIPTQIV-------------------------
2cyjA           ------------------LLVGTGIYGMLSLLPESKKLVEDKEVIEKPTKEALK-LLEELWGKKRILAI-
1bgnA           ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLL
1e0dA           -----------------NVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTGSLND
2c73B           ---------------KCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGG
2c73A           ---------------KCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGG
2brxA           ------------------AVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRA--NAMLLIAALREKA
3cp8A           --------------HMYDVIVVGAGHAGCEAALAVARGGLHCLLITSDLSAVARMSCNPAIGGVAKGQIT
2drvA           -----------------RSPILHVGAKTLEDAVKLVNLAVSCGFKYSNIKSILIVEIRSTEGEIFVGEEY
3bi4B           ------------------VIIIGAGIAGLAASTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGA
3cirM           ------------QTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEG-GSAAVAQ
3c96A           -----------------DILIAGAGIGGLSCAALHQAGIGKVTLLESSSEIRPLGVG-------------
1b73A           ------------------IGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLEC


                         +         .         .         .         .         *         .:210
query           ITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAH
1d4cB           AKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWLTSMGAD----------------MTDVG
1e39A           NAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDV
2b7sA           KAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADL---------TDVGMMGGASV
2b7rA           TDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMT-----AMGADLTDVGMMGGASV
1d4cA           AKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWL------------TSMGADMTDVGRMGG
1d4cC           AKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWLTSMGAD----------------MTDVG
1cf3A           PNAKQ-IAAGHYFNASCHGVNGTVHAGPR-DTGDDYSPIVKALMSAVEDRGVPTKKDFGCGDPHGVSM-F
1d4dA           AKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWLTSMGAD----------MTDVGR--MGG
3c4nA           --AQDIPAGQEAQAEWTREQLLGALGSGKTLEVEDRPLLHLLPAGEGSGLTPTLDALADFPEALALLDPA
3djeA           SNNKDEIEVNEILAEEAFNGWKNDPLFKPYYHDTGLLSACSQEGLDRLGVRVRPGEDPNLVELTRPEQFR
3djeB           KDEIEVNEILAEEAFNGWKNDPLFKPYYHDTGLEGLDRLGVRVRPGEDPNLVELTRPEQFRKLAPEGVLQ
2bs2A           SKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAKGDRMAIINAQKTTITEEDFRHGLIH
2dkiA           AFEFADSILKEACWINDVTFWKPDPGQPGRIARHGRVQDTEDGLSEFPHVILNQARVHDHYLER-MRNSP
1b3mA           GREYVPLALRSLWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPG
2dkhA           AFEFAD---SILKEACWINDVTFWKPDPGQPGRIARHGRVQDTEDGLSEFPHVILNQARVHDHYLERMRN
2c76A           SYV---GPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSY----PFRGPFPPVWNPITYLDHNNFWRT
3cesC           ---------KGHLVKEVDALG----------------GLMAKAID--------------------QAGIQ
2c72A           SYVG-------PTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRT
3bhfA           GREYVPLALRSQELWYELEKETHHKIFTKTGVLKGESAFVAETMEAAKEHSLTVDL---LEGDEINKRWP
2cfyA           RMIEAVQNHIGSLNWGYRVALREKKVVYENAYQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGI
3cp8D           REIDALGGEMGKAIDATGIQFRMLNRSKGPAMHSPRAQADKTQYSYMRRIVEHEPNIDLLQDTVIGVSAN
3blyA           ----------------------------------------------------------------------
3cesA           LGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQ-------------
3bhkA           REYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWP
1cc6A           LREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA---SGATTVY
2bxsA           ----------------------------------------------------------------------
3dmeA           DSLKARLCVRGKLYEYCAARGVPHQRLGKLIVATSDA-EASQLDSIARRAGANGVDDLQHIDGAAARRLE
2dpoA           ----------------------------------------------------------------------
1cc4A           REAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYG-------------------------
1bhyA           ----------------------------------------------------------------------
2c75B           YVGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRG--------PFPPVWNPITYLDHNNFWRT
2bxrA           ----------------------------------------------------------------------
3cp2A           LGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVED--------
3cukA           PADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWF
2bk4B           S------YVGPTQN----RILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNF
1e6eC           VINTFTQTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSY----------------------------
1bgjA           REAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAE
1b37A           ----------------------------------------------------------------------
2e4gA           LGIPEDEWMRECNASTAGEGTSEARELDGGPDHFYHSFGLLKYHEQIPLSHYWFDRSYRGKTVEPFDYAC
1cjcA           VINTFTQTARSDCAFYGNVEVGRDVTVQELQDAYHAVVLSYG----------------------------
3cesB           LGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVED--------
3b3rA           SSWFKNRTEAPLGSFLWLDVVNRNIDPYA-----------------------------------------
2culA           ----------------------------------------------------------------------
1d7lA           REAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGA--------
1b8sA           RSSWFKNRTEAPLGSFLWLDVVNRNIDPY-----------------------------------------
3djdA           EILAEEAFNGWKNDPLFKPYYHDTGLLSACSQEGLDRLEDPNLVELTRPEQFRK--LAPEGVLQGDFPGW
1d5tA           ----------------------------------------------------------------------
1bf3A           AHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQGERPYVT
3d4oC           ----------------------------------------------------------------------
3cgvA           KADRSFIANEVKGARIYGPSEKRPIILQNEVGYVLERDKFDKHLAALAAKGAKIRHNNEIVDVRAKVIAA
3cesD           -------HLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADR------------------V
3dghB           PKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFV
3djdB           NEILAEEAFNGYHDTGLLSACSQEGLDRLNLVELTRPEQFRKLAPEGVLQGDFPGWKGYFARSGAGW-AH
2aejB           ----------------------------------------------------------------------
1cj4A           AGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVR
3coxA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bgnA           REAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAE
1e0dA           EWLMA-ADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQAPIVAITGSNGKSTVTTLVGEMAKA
2c73B           SYVGPTQNRILRLAKELGLETYKVNEVERLIH--------------------------------------
2c73A           SYVG------------------------------------------------------------------
2brxA           YPVVVEDFWEAWKA---VQLKKIPVMGGTHPGHTTDAVAALL------AEFLKADLLVVITNVDGVYTAD
3cp8A           REIDALGGEMGKAIDATGIQFRMLNRSKGPAMHS------------------------------------
2drvA           LNKIVEIANDQRRFKE------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3cirM           D----HDSFEYHFHDTVAGGDWLCEQDVVDYFVH----HCPTEMTQLELWGCPWSRRPDGSVNVRRFGGM
3c96A           ----------------------------------------------------------------------
1b73A           AGFLKDKGVDIIVACNTASAYALERLKKEINV--------------------------------------


                         .         .         .         +         .         .         .:280
query           PGSHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNY
1d4cB           RMGGASVNRSHRPTGGAGVGAH-VAQVLWDNAVKRGTDIRLNSRVVRILEDAS--GKVTGVLVKGEYTGY
1e39A           GMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDK--GTVKGILVKGMYKG-
2b7sA           NRAHRP-------TGGAGVGAHVVQVLYDN-AVKRNIDLRMNTRGIEVLKDDK--GTVKGILVKGMYK-G
2b7rA           NRAHRPT-------GGAGVGAHVVQVLYDN-AVKRNIDLRMNTRGIEVLKDDK--GTVKGILVKGMYKGY
1d4cA           ASVNRSHRPTGGAGVGAH-----VAQVLWDNAVKRGTDIRLNSRVVRILEDAS--GKVTGVLVKGEYTG-
1d4cC           RMGGASVNRSHRPTGGAGVGAH-VAQVLWDNAVKRGTDIRLNSRVVRILEDAS--GKVTGVLVKGEYTG-
1cf3A           PNTLH---------EDQVRSDAAREWLLP-NYQRPNLQVLTGQYVGKVLLSQNGTPRAVGVEFGTHKGNT
1d4dA           ASVNRSHRPTGGAGVGAHVAQVL-----WDNAVKRGTDIRLNSRVVRILEDG---KVTGVLVKGEYTGYY
3c4nA           RLPVARVDPRAAAQQAIGQGAGLLLNTRAE-LVPGGVRLHRLTVVHETRQGAAGPALVEQGLGLHTRHGR
3djeA           KLAPEGVLQGDFPGWKGAHARNALVAAARE--AQRGVKFVTGTPQGRVVTLIFENNDVKGAV--TADGKI
3djeB           GDFPGWKGYFARSGAGWAHARNALVAAARE--AQRGVKFVTGTPQGRVVTLIFENNDVKGAV--TADGKI
2bs2A           SRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYG---AVVRDLVTGDI
2dkiA           SRLEPHYARRVLDVKVDHGAADYPVTVTLERCDAAHAGQIETVQARYVVGCDGARSNVRRAIGRQLVGDS
1b3mA           ITVPENYNAIFEPNSGVLFSENCIRAYR-ELAEARGAKVLTHTRVEDFDISP---DSVKIETANGS----
2dkhA           SPSRLEPHYARRVLDVKVDHGAADYPVTVERCDAAHAGQIETVQARYVVGCDGARSNVRRAIGRQLVGDS
2c76A           MDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKL---CWTESAKQLATLFVNLCVTAETHEVSALWFLWY
3cesC           FRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVEDLIVEN---DRVVGAVTQ--MGLK
2c72A           MDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFTAETHEVSALWFLWYVKQCGGT-
3bhfA           GITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANGSYTADKLI
2cfyA           PGDKEYCISSDDLFSLPYCPGKTLVNKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEE
3cp8D           SGKFSSVTVRSGRA---IQAKAAILA--------------------------------------------
3blyA           ------------------------------------------------VVRNALNSEIESLHIHDLISGD
3cesA           ----------------------------------------------------------------------
3bhkA           GITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPDANGSYTADKLIVSMGAW
1cc6A           QAAEVRLHDLQG----------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3dmeA           PALH--CTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRP---EGGFELDFGGAEPMT
2dpoA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2c75B           MDDMGREIPSDAPWKAPLAEEWDNMTMKELL---DKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWY
2bxrA           ----------------------------------------------------------------------
3cp2A           ----------------------------------------------------------------------
3cukA           HTSLIL----------------------------------------------------------------
2bk4B           WRTMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESA---------------------------
1e6eC           ----------------------------------------------------------------------
1bgjA           VRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFRGISRQSIPAERLKVFERVYPFGWLGLLADTPPVS
1b37A           ----------------------------------------------------------------------
2e4gA           YKEPVILDANRSPRRLDGSKVTNYAWHFDAHLVADFLRRFATEKLGVRHVRVEHVQRDANGNIESVRTAT
1cjcA           ----------------------------------------------------------------------
3cesB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3djdA           KGYF------ARSGAGWAHARNALVAAARE--AQRGVKFVTGTPQGRVVTLIFENNDVKGAVTAD-----
1d5tA           ----------------------------------------------------------------------
1bf3A           FERDGERLRLDCDYIAGCDGFHGISSIPAERLKVFERVYPFG---WLGLLADTPPVSHELIYANHPRGFA
3d4oC           ----------------------------------------------------------------------
3cgvA           DGFESEFGRWAGLKSVILARNDIISALQYRINVDVDPDYTDFYLGAGYIWVFPKGEGANVGIGSSINWIH
3cesD           LYRQAVRTALENQPNLMIFQAVEDLIVENDRVVGAVTQMGLKFRAKAVVL---TVGTFLDGKISIPLSRR
3dghB           DSHTLL----------------------------------------------------------------
3djdB           -ARNALVAAAREAQRGVKFVTGTPQGRVVTLIFENNDVKGAVTADGKIWRAE------------------
2aejB           ----------------------------------------------------------------------
1cj4A           LHDLQG----------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bgnA           VRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVS
1e0dA           AG--------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
2brxA           P---------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3cirM           KIERTWFAADK-------TGFHMLHTLFQTSLQFPQIQRFD---EHFVLDILVDDGHVRGLVAMNMMEGT
3c96A           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VKYVGRKAIVLATGDFSANQDMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTL
1d4cB           YV-IKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPGA----------TGDGLDVALQAGAATRDLE
1e39A           YYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAV----------GDGLDVAENAGGALKDMQ
2b7sA           YYWVKADAVILATGGFAKNNERVAKLDPSLKGFIST----------NQPGAVGDGLDVAENAGGALKD--
2b7rA           YWV-KADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAV----------GDGLDVAENAGGALKDMQ
1d4cA           YYVIKADAVVIAAGG----------FAKNNERVSKYDPKLKGFKATNHPGATGDGLDVALQAGAATRDLE
1d4cC           YYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPGA----------TGDGLDVALQAGARDLEYI
1cf3A           HNVYAKHEVLLAAGSAVSPTILEYSGIGMKSILEPL----------------GIDTVVDLPVGLNLQTAT
1d4dA           V--IKADAVVIAAGGFAKNNERVSKYDPKLKGFKATN------HPGATGDGLDVALQAGAAT--RDLQYI
3c4nA           A-YRQFPRLDLLSGAQTPVLRASGLTLRPQNGGYTLVPAIHHRDPHGYHPAGGSLTGVP-----------
3djeA           WR---AERTFLCAGASAGQFLDFKNQLRPTAWLYKNIPVIFNIERGFFFEPDEERGEIKICDEHPGYTNV
3djeB           WR---AERTFLCAGASAGQFLDFKNQLRPTAWTLVHIALKPEER--------------------------
2bs2A           IAYVAKGTLIATGGYGRIYKNTNAVVCEGTGTAIALETGIAQLGNME-----------------------
2dkiA           ANQAWGVMDVLAVTDFPDVRYKVAIQSEQGNVLIIPREGGHLVRFYVEMDRNITVEQLIATAQRVLHPYK
1b3mA           ---YTADKLIVSMGAWNSKLLSKLNLDIPQLP--------------------------------------
2dkhA           ANQAWGVMDVVTDFPDVRYKVAIQSEQGNVLIIPREGGHLVRFYVEMDNITVEQLIATAQRVLHPYKLEV
2c76A           VKQCGGTTRIISTTNGGQERKFVGGSGQVSE---RIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMY
3cesC           FR---AKAVVLTVGTFLDGKIHIGRLKTGTPPRIDARTIDFSVLQQHG----------------------
2c72A           TRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTREN---------------------
3bhfA           VSMGAWNSKLLSKLNLDIPLQPYRQVVGFFESDESKYSPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQ
2cfyA           IIEGEYNTVMLAIG-RDAC----------------------TRKIGLETVGVKINEKTGKIPVTDEEQT-
3cp8D           ----------------------------------------------------------------------
3blyA           RFEIKADVYVLTAGAVHNTQLLVNSGFGQLGRPNPANPPELLPSLGSYITEQSLVFCQTVMSTELIDSVK
3cesA           ----------------------------------------------------------------------
3bhkA           NSKLLSKL--------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3dmeA           LSC---RVLINAAGLHAIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHL--------
2dpoA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2c75B           VKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVL---VETLNHEMY
2bxrA           ----------------------------------------------------------------------
3cp2A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1e6eC           ----------------------------------------------------------------------
1bgjA           HELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKSIA
1b37A           ----------------------------------------------------------------------
2e4gA           GRVFDADLFVDCSGFRGLLINKMSDHLLNDSAVATQVPHDDDANGVEPFTSAIAMKSGWTWKIPML----
1cjcA           ----------------------------------------------------------------------
3cesB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3djdA           GKIWRAERTFLCAGASAGQFLDFKNQL-------------------------------------------
1d5tA           ----------------------------------------------------------------------
1bf3A           LCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKSIAPLRSFVVEPMQHG
3d4oC           ----------------------------------------------------------------------
3cgvA           NRFELKNYLDRFIENHPGLKKGQDIQLVTGGVSVSKVKPILLVGDAARLIDPITGGGIANAIVSG-----
3cesD           LRELPLRVGRLKTDARTIDFSVLAQQHGDPMPVFSFMGNASQHPQQVPCYITH----TNEKTHDVIRSNL
3dghB           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bgnA           HELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKSIA
1e0dA           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3cirM           LVQIRANAVVMATGGAGRVYRYNTNMGMALSHGVPLRDMEFVQYHPAGLPGSGILMTEGCRDKVSQAISK
3c96A           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PNAPMIDAVGPMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW
1d4cB           YAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFDDSIRKS----
1e39A           YIQPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKI
2b7sA           MQYIQAHPTLSVKGGVMVTENGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKI
2b7rA           YIQPTLSVKGGVMVTDAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKI
1d4cA           YAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVF------DDSIR
1d4cC           QAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFDDSIRKS----
1cf3A           VRSRITSAATFNETFGDYSEKAHELLNTKLEQWAEEAVARGGFHNTTALLI-----QYENYRDWIVNHNV
1d4dA           QAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFDDSIRKSLKAI
3c4nA           ----------------------------------------------------------------------
3djeA           QSADGTSIPFEKTQIPKEAET-------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
2dkiA           LEVKNVPWWSVYEIGQRICAKYDDVVDAVATPDSPLPRVFIAGDACHTHSPKAGQGMNFSMQDSFNLGWK
1b3mA           ----------------------------------------------------------------------
2dkhA           KNVPWWSVYEIGQRICAKYDDVVDAVATPDSPLPRVFIAGDACHTHSPKAGQGMNFSMQDSFNLGWKLAA
2c76A           EAKYVISAIPPTLGMK--------IHFNPPLPMMRNQMITRVPLGSVIKCIVYYKEPFWRCGTMIIDGEE
3cesC           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
3bhfA           KIDPDTINREFGVYPEDESNL-------------------------------------------------
2cfyA           -NVPYIDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEE
3cp8D           ----------------------------------------------------------------------
3blyA           SDMTIRGTPGELTYSVTYTPGASTNKHPDWWNEKVKNHMMQHQEDPLPIPFEDPEPQVTTLFQPSHPWHT
3cesA           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3dmeA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2c75B           EAKYVISAIPPTLGMK-IHFNPPLPMMR---------------NQMITRVPLGSVIKCIVYYKEPFWRKK
2bxrA           ----------------------------------------------------------------------
3cp2A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1e6eC           ----------------------------------------------------------------------
1bgjA           PLRSFVVEPMQHGRLFLAGDAAHIVPPTGAK---------------------------------------
1b37A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
3cesB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
1bf3A           RLFLAGDAAHIVPPTGNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVL---
3d4oC           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
3cesD           SIEDKVMRNQHQIFLEPEGLTSNEIGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAI-EYDFFDPRDLK
3dghB           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bgnA           PLTSFVVEPMQHGRLFLAGDAAHIVPPTGAK---------------------------------------
1e0dA           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3cirM           KLHEFICELAKAYPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRNSLAELVVFGR----
3c96A           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVERYNELCEAKY
1d4cB           ---------------------LKAIEGYVHLNIVKEGKTIEELAKQI-DVPAAELAKTVTAYNGFVKSGK
1e39A           DKY--------------------------IGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGK
2b7sA           DKY-------------------------IGLGVAPTADSLVK-LGKMEGIDGKALTETVARYNSLVSSGK
2b7rA           DKY--------------------------IGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGK
1d4cA           KSLKAIEGYVHLNIVKEGKTI--------------------EELAKQIDVPAAELAKTVTAYNGFVKSGK
1d4cC           ---------------------LKAIEGYVHLNIVKEGKTIEE-LAKQIDVPAAELAKTVTAYNGFVKSGK
1cf3A           AYSELFLDTAGVASFDVWDLLPFTRGYVHILDKDPYLH------HFAYDPQYFLNELDLLGQAAATQLAR
1d4dA           EGY-------------------------VHLNIVKEGKTIEELA-KQIDVPAAELAKTVTAYN--GFVSG
3c4nA           ----------------------------------------------------------------------
3djeA           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
2dkhA           VLR-------------------------------------------------------------------
2c76A           APVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYAKVLGSLEALEPVHYEEKN----
3cesC           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
2cfyA           NIEVYHSYFWPLEWRDNNKCYAKIIDNERVVGFHVLGPNAGEVTQGFCGLTKKQLDSTIEVFTTLSVTKR
3cp8D           ----------------------------------------------------------------------
3blyA           QIHRDAFSYGAVQQSIDSRLIVDWRFFGREPKEENKLWFSDKITDAYNMPQPTFDFRFPAGRTSKEAEDM
3cesA           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3dmeA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2c75B           DYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLA----RLTKEERLKKLCELYA------
2bxrA           ----------------------------------------------------------------------
3cp2A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1e6eC           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
3cesB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
3cesD           PTLESKFIQGTGYEEAAAQGLLAGLNASADKEGWAYLGVLVDDLCTLGTKEPYRMFTSRAEY--------
3dghB           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQNEPIEGLYNLGIMVGDSYAN
1d4cB           DAQFERPDL---PRELVVAPFYALEIAP-AVHHTMGGLVIDTKAEVSEKTGKPITGLYAAGEVTGGVHGA
1e39A           DTDFERPNLPRALNEGNYYAI---EVTPGVHHTM-GGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGA
2b7sA           DTDFERPNLPR-ALNEGNYYAIEVTP---GVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGA
2b7rA           DTDFERPNLPRALNEG-NYYAIEVTP---GVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGA
1d4cA           DAQFERPDL---PRELVVAPFYALEIAPAVHHTMGGLVIDTKAEVKSEKTGKPITGLY----AAGEVTGG
1d4cC           DAQFERPDLPRELVVAPFYALEIAPAVH----HTMGGLVIDTKAEVKSETGKPITGLY----AAGEVTGG
1cf3A           NISNSGAMQTYFAGETIPGDNLAYDADLSAWTEGVGTCSMMPKEMGGAARVYGVQGLRVIDGSIPPTQM-
1d4dA           KDAQFERPDLPRELVVAPFYAL--EIAPAVHHTMGGLVIDTKAEVKSEKTAKPITGLYAAGEVTGGVHGA
3c4nA           ----------------------------------------------------------------------
3djeA           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bs2A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
3cesC           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
2cfyA           SGASI-----------------------------------------------------------------
3cp8D           ----------------------------------------------------------------------
3blyA           MTDMCVMSAKIGGFLPGSWPQFMKPGLLHLGGTHRMGFDEKEDNCCVNTDSRVFKNLF----LGGCG---
3cesA           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
3dmeA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
3cp2A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1e6eC           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
3cesB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
3cesD           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           CYNFAICGHNLGMNCNTFAYMLGKDLAEx
1d4cB           NR----LGGNAISDIVTYGRIAGASAAK-
1e39A           NR----LGGNAISDIITFGRLAGEEAAK-
2b7sA           NR---LGGNAIS-DIITFGRLAGEEAAK-
2b7rA           NR---LGGNAIS-DIITFGRLAGEEAAK-
1d4cA           VHGANRLGGNAISDIVTYGRIAGASAAK-
1d4cC           VHGANRLGGNAISDIVTYGRIAGASAAK-
1cf3A           -------SSHVMTVFYAMALKISDAILE-
1d4dA           NR---LGGNAIS-DIVTYGRIAGASAAK-
3c4nA           -----------------------------
3djeA           -----------------------------
3djeB           -----------------------------
2bs2A           -----------------------------
2dkiA           -----------------------------
1b3mA           -----------------------------
2dkhA           -----------------------------
2c76A           -----------------------------
3cesC           -----------------------------
2c72A           -----------------------------
3bhfA           -----------------------------
2cfyA           -----------------------------
3cp8D           -----------------------------
3blyA           -----NIPTAYGANPTLTAMSLAIKSCE-
3cesA           -----------------------------
3bhkA           -----------------------------
1cc6A           -----------------------------
2bxsA           -----------------------------
3dmeA           -----------------------------
2dpoA           -----------------------------
1cc4A           -----------------------------
1bhyA           -----------------------------
2c75B           -----------------------------
2bxrA           -----------------------------
3cp2A           -----------------------------
3cukA           -----------------------------
2bk4B           -----------------------------
1e6eC           -----------------------------
1bgjA           -----------------------------
1b37A           -----------------------------
2e4gA           -----------------------------
1cjcA           -----------------------------
3cesB           -----------------------------
3b3rA           -----------------------------
2culA           -----------------------------
1d7lA           -----------------------------
1b8sA           -----------------------------
3djdA           -----------------------------
1d5tA           -----------------------------
1bf3A           -----------------------------
3d4oC           -----------------------------
3cgvA           -----------------------------
3cesD           -----------------------------
3dghB           -----------------------------
3djdB           -----------------------------
2aejB           -----------------------------
1cj4A           -----------------------------
3coxA           -----------------------------
2cyjA           -----------------------------
1bgnA           -----------------------------
1e0dA           -----------------------------
2c73B           -----------------------------
2c73A           -----------------------------
2brxA           -----------------------------
3cp8A           -----------------------------
2drvA           -----------------------------
3bi4B           -----------------------------
3cirM           -----------------------------
3c96A           -----------------------------
1b73A           -----------------------------