[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV54398.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dlpX.bssp"
#ERROR : Can't open dsspfile "2d1qA.bssp"
#ERROR : Can't open dsspfile "3cw9A.bssp"
#ERROR : Can't open dsspfile "2c4iA.bssp"
#ERROR : Can't open dsspfile "3cw8X.bssp"
#ERROR : Can't open dsspfile "3bl4A.bssp"
#ERROR : Can't open dsspfile "2d1rA.bssp"
#ERROR : Can't open dsspfile "2d1tA.bssp"
#ERROR : Can't open dsspfile "2d1sA.bssp"
#ERROR : Can't open dsspfile "3c5eA.bssp"
#ERROR : Can't open dsspfile "3dhvA.bssp"
#ERROR : Can't open dsspfile "3b7wA.bssp"
#ERROR : Can't open dsspfile "3dayA.bssp"
#ERROR : Can't open dsspfile "2d42A.bssp"
#ERROR : Can't open dsspfile "3c30A.bssp"
#ERROR : Can't open dsspfile "2atwA.bssp"

## Summary of PDB Search
:447
    4e-16  14%  3dlpX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
    4e-15  14%  2d1qA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    9e-15  14%  3cw9A  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    6e-14  13%  2c4iA  [x.x.x] AVIDIN
    1e-12  14%  3cw8X  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    2e-12  14%  3bl4A  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-11  14%  2d1rA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    3e-11  15%  2d1tA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    2e-10  13%  2d1sA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    1e-08  13%  3c5eA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    2e-08  13%  3dhvA  [x.x.x] D-ALANINE-POLY(PHOSPHORIBITOL) LIGASE
    8e-07  10%  3b7wA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    3e-06  15%  3dayA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    2e-05   6%  2d42A  [x.x.x] NON-TOXIC CRYSTAL PROTEIN
    9e-05  10%  3c30A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    3e-04  11%  2atwA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
:447

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxYYDPEIECMPRPELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFP
3dlpX           ---------------------LLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQS----GSGARII
2d1qA           ----------------------------------------------------------------------
3cw9A           ---------------------------------AELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARII
2c4iA           ----------------------------------------------------------------------
3cw8X           ----------LALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARIIFLGD
3bl4A           ----------------------------------------------------------------------
2d1rA           ----------------------------------------------------------------------
2d1tA           ----------------------------------------------------------------------
2d1sA           ----------------------------------------------------------------------
3c5eA           ----------------------------------------------------------------------
3dhvA           ----------------------------------------------------------------------
3b7wA           ------------------------------RLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKS
3dayA           ----------------------------------------------------------------------
2d42A           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FCDKKTERETQHVGSFFGEMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPN
3dlpX           FLGDLVRDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLR-HGRH
2d1qA           ------------------SSFKTVEVDRKEQVALIMNSSLPKGVQLTHENIVTRFSHARDPIYGNQVSPG
3cw9A           FLGDLVRDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAA-ESRVLFMSTQVGLRHGRH
2c4iA           ----------------------------------------------------------------------
3cw8X           LVRDGEPYSYGP----PIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMST-QVGLRHGRH
3bl4A           ----------------------------------------------------------------------
2d1rA           -----------------------RKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQVSPG
2d1tA           ----------------------DRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQVSPG
2d1sA           ------------------TVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQVSPG
3c5eA           ----------------------------------------------------------------------
3dhvA           -----------------------------------------------------------------NLQTG
3b7wA           CDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWT---GLQAS
3dayA           ----------------------------------------------------------------------
2d42A           -----------------------------------------------------LLRELEIYGMQYANSHQ
3c30A           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGF
3dlpX           NVVLGLMPLYHVVGFFAVVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPT---HLDALAAAAAH
2d1qA           TAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSELLN--
3cw9A           NVVLGLMPLYHVVGFFAVVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPT---HLDALAAAAAH
2c4iA           -------------CFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLKCSLTGK---------
3cw8X           NVVLGLMPLYHVVGFFAVVAALALDGTYVVIEEFRPVDALQLVQQEQVTSLFATPT---HLDALAAAAAH
3bl4A           ----------------------------------------------------------------------
2d1rA           TAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSELLNK-
2d1tA           TAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTNVILVPTLFAILNKSELL---
2d1sA           TAVLTVVPFHHGFGMFTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSELLNKY
3c5eA           ---------------------------------------------------------------------L
3dhvA           QVFLNQAPFSFDLSVMDIYPSLVTGGAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSE-
3b7wA           DIMWTISDTGXXXXXXXXXXXXXXXXXXXXXXXLPKFDPL-VILKXXXXXXXXXXXXXXXXXXXXXXXDL
3dayA           ----------------------------------------------------------------------
2d42A           YTYGSSYSDDTNPIR------IAGLDARIPDPIVTDPVNHIVLDRRIITNTTSNSLEGVF---SFSNAYT
3c30A           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDGLHIVEDQILVET
3dlpX           AGSLKLDSLRHVTFAGATMP-DAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQTGTEMAPGFFSEVRIVR
2d1qA           --KYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDKPGASGKVVPLFK
3cw9A           AGSLKLDSLRHVTFA-GATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQTGTEMAPGFFSEVRIVR
2c4iA           -WTNDLGSNMTIGAVNSRGEGTYITAVTATSNEIKESPLHGTQNTIGSTTVCFIDRNGKEVLKTMWLLRS
3cw8X           AGSLKLDSLRHVTFAGATMP-DAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQTGTEMAPGFFSEVRIVR
3bl4A           --------------------------------------------------SEVGTEAGLTLGGD-GILRL
2d1rA           ---YDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITDDKPGASGKVVPLFKAKV
2d1tA           -NKYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDASGKVVPLFKAKV
2d1sA           DL---SNLVEIASGGAPLSKE--VGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDSGKVVPLFKAKV
3c5eA           SSYKFPHLQNCVTVGES--LLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKIGYMGTAASCYDVQ
3dhvA           ---SMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGLDQYKSLPVGYCKSDCRLL
3b7wA           SSYKFPHLQNCVTVGES--LLPETLENWRAQTGLDIRESYGQTETGLTCMVSMKIKPGYMGTAASCYDVQ
3dayA           --SYKFPHLQNCVTVGESLL-PETLENWRAQTGLDIRESYGQTETGLTCMVSKKIKPGYMGTAASCYDVQ
2d42A           SRTSSQTRDGVTAGTNITGKYFANLFFEQVGLSGRIAFEGAVTNENKYTLDATQDFRDSQTIVLECVVSG
3c30A           -------------------------------------------------------------------QSL
2atwA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRTLARIHVTGRKDEMFIVGAVN
3dlpX           IGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPILGRVPDMIISGGEN
2d1qA           IDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWLHTGDIGYYFFIVDRLKSLIKYKGYQ
3cw9A           IGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWVRILGRVDDMIISGGEN
2c4iA           SVNDIGDDWKATRVGINIFTRLSARKCSLTGKWTNDLGSNMTIGAVNSFTGTYITAVTATSNEIKESPLH
3cw8X           IGGGVDEIVANGEEGELIVAASDSAFVGYLNQPEATAEKLQDGWYRTSDVAVTVRILGRVDDMIISGGEN
3bl4A           TWPRGAAITAAAERALRVNQLCGDDRHPLVDATTADVSRGARAVFGRPCQASRILLGSSPVDRVLANGIN
2d1rA           IDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWLHTGDIGYYFFIVDRLKSLIKYKGYQ
2d1tA           IDLDTKKSLGPNRRGEVCVKGPMLMKGYVNATKELIDEEGWLHTGDIGYYDEEFFIVDRLKSLIKYKGYQ
2d1sA           IDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKEGWLHTGDIGYYDEEKHFFIVDRLKSLIKYKGYQ
3c5eA           IIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKTAANIRGDFWLLGDRQFMGRADDIINSSGYR
3dhvA           IMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMYKTGDAGYVENGLLFYGRLDFQIKLHGYR
3b7wA           IIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYR
3dayA           IIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSKTAANIRGDFWLLGDRGIKDEDFQFMGRADDIINSSGYR
2d42A           NGIIRYYRTLPDNSYTEIVQRVNIIDVLQANGTPGFTISKEQN---RAYFTGEISGQIGLQTFIDVVIEP
3c30A           FDFR-LAALRIHQDSTAKNASLINSVDELELSNAPDLRFISSHDNILWDD-GNASFYGIAQQELNKLIRR
2atwA           ----EGEIVAGVIQRDSRRIGTETKASEGVIQVPGESYEHGNRLRCYVVGVTRLITLSRTHPNLVRKLFS


                         .         .         .         .         *         .         .:420
query           VFPSDIEYVVRGLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVI
3dlpX           IHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVRLGETLSADALDTFCRSSELADFK--RPKRYF
2d1qA           VPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAKRLRGGVRF
3cw9A           IHPSEIERVLGTAPG-------------------------------------------------------
2c4iA           GTQNTINKRTQPTFG-------------------------------------------------------
3cw8X           IHPSEIERVLGTAPGVT-EVVVIGLADQWGQSVTACVVPRLGETLSADALDTFCRSSELADFKR-PKRYF
3bl4A           AVPCPTKFFTSERDA-------------------------------------------------------
2d1rA           VPPAELESVLLQHPS-------------------------------------------------------
2d1tA           VPPAELESVLLQHPSIFDAG--------------------------------------------------
2d1sA           VPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMEKEVMDYVASQVSNAK--RLRGGVR
3c5eA           IGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVASQFLSHDPEQLTKELQQHVKSVTAPYKYPRK
3dhvA           MELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRK
3b7wA           IGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHDPE---------------------
3dayA           IGPSEVENALMEHPAVVETAVISSPDRGEVVKAFVVLA--------------------------------
2d42A           LPG-------------------------------------------------------------------
3c30A           VAISGNWHLVQTPSE-------------------------------------------------------
2atwA           LEVPEIADGSVEIVA-------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VYDAGKLGTSSEHKASRxxxxxxxxxx
3dlpX           ILDQL----------------------
2d1qA           V--------------------------
3cw9A           ---------------------------
2c4iA           ---------------------------
3cw8X           ILDQ-----------------------
3bl4A           ---------------------------
2d1rA           ---------------------------
2d1tA           ---------------------------
2d1sA           FVDEV----------------------
3c5eA           IEFVLNLPKTVTGKIQR----------
3dhvA           FMYQSSIPMTPNGKVDR----------
3b7wA           ---------------------------
3dayA           ---------------------------
2d42A           ---------------------------
3c30A           ---------------------------
2atwA           ---------------------------