[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV54491.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cloA.bssp"
#ERROR : Can't open dsspfile "3c57B.bssp"
#ERROR : Can't open dsspfile "3c57A.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "1co0A.bssp"
#ERROR : Can't open dsspfile "2d9sA.bssp"
#ERROR : Can't open dsspfile "3clmA.bssp"
#ERROR : Can't open dsspfile "3cloC.bssp"
#ERROR : Can't open dsspfile "2dk5A.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "2efnA.bssp"
#ERROR : Can't open dsspfile "2cg4A.bssp"
#ERROR : Can't open dsspfile "2dvpA.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "2dbbA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"

## Summary of PDB Search
:519
    3e-12  36%  3cloA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    4e-12  29%  3c57B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    4e-11  30%  3c57A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    9e-10  26%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-09  26%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-08  14%  1co0A  [a.4.12] TRP OPERON REPRESSOR
    3e-08  28%  2d9sA  [x.x.x] CBL E3 UBIQUITIN PROTEIN LIGASE
    3e-06   9%  3clmA  [x.x.x] TRANSALDOLASE
    3e-05  35%  3cloC  [x.x.x] TRANSCRIPTIONAL REGULATOR
    9e-05  10%  2dk5A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    1e-04  40%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    1e-04  17%  1dpuA  [a.4.5] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    2e-04  15%  2efnA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-04  11%  2cg4A  [x.x.x] REGULATORY PROTEIN ASNC
    3e-04   7%  2dvpA  [x.x.x] HYPOTHETICAL PROTEIN PH1917
    4e-04  15%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    8e-04  15%  2dbbA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    8e-04  17%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
:519

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2dk5A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2dk5A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2dk5A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2dk5A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2dk5A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2dk5A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
2dbbA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxAPDVHDALPHANKLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLVITQSTAKTHL
3cloA           ---------------------------------ILSEREKEILRCIRKGLSSKEIAATLYISVNTVNRHR
3c57B           -----------------------------------TDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYV
3c57A           ----------------------------------LTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYV
3c3wA           --------------------KLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYV
3c3wB           --------------------KLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYV
1co0A           ---------------------------------ALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGS
2d9sA           ----------------------------------------EIERLMSQGYSYQDIQKALVIAHNNIEMA-
3clmA           --------LDATLPDRLKGKTAIALAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKNPAYPDT
3cloC           ------------------------------------------------GLSSKEIAATLYISVNTVNRHR
2dk5A           ---------------------------------GSDNQEKLVYQIIEKGIWSRDVRYKSNLPLTEINKIL
1a04A           -------------------------------------RERDILKLIAQGLPNKMIARRLDITESTVKVHV
1dpuA           --------------------------------NGLTVAQNQVLNLIKAGLNFQDLKNQLHMSVSSIKQAV
2efnA           ----------------------------------MDEIDLRILKILQYNASLDEIAREIRIPKATLSYRI
2cg4A           --------------------------------YLIDNLDRGILEALMGNAAYAELAKQFGVSPETIHVRV
2dvpA           ---------SVIGFYIDGKAYKFSGVTWGRISNEKRGTHGFGYDPIFIPEGSEKTFAEMTIEEKNALSHR
1bibA           ---------------------------------KDNTVPLKLIALLANGESGEQLGETLGMSRAAINKHI
2dbbA           ---------------------------------KLDRVDMQLVKILSENSTYRELADILNTTRQRIARRI
3cwoX           -----------------------------------TGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYD


                         *         .         .         .         .         +         .:560
query           RNIYAKMDVHNQQEILNLVEQTIDExxxx
3cloA           QNILEKLSVGNSIEACRAAEL--------
3c57B           SRLLAKLGMERRTQ---------------
3c57A           SRLLAKLGMERRTQ---------------
3c3wA           SRLLAKLGMERRTQAAVFA----------
3c3wB           SRLLAKLGMERRTQAAVFA----------
1co0A           NSL-KAAPVELRQWLEEVLLK--------
2d9sA           KNILREFSGPS------------------
3clmA           LYVDSLIGVHTVNTVPDATLKAF------
3cloC           QNILEKLSVGNSIEACRAAEL--------
2dk5A           KN---------------------------
1a04A           KHMLKKMKLKSRVE---------------
1dpuA           DFLSNEGHIYSTVD---------------
2efnA           KKLEKDGVIKGYYAYINPASLNLDY----
2cg4A           EKMKQAGIITGARIDVS------------
2dvpA           GKALKAF-FEWLKVNL-------------
1bibA           QTLRDWGVDV-------------------
2dbbA           DKLKKLGIIRKFTIIPD------------
3cwoX           TEMIRFVRPLTTLPIIASGGAGKME----