[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV54505.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cloA.bssp"
#ERROR : Can't open dsspfile "3c57A.bssp"
#ERROR : Can't open dsspfile "3c57B.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "3cloC.bssp"
#ERROR : Can't open dsspfile "1co0A.bssp"
#ERROR : Can't open dsspfile "2d9sA.bssp"
#ERROR : Can't open dsspfile "2cg4A.bssp"

## Summary of PDB Search
:520
    9e-14  28%  3cloA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    8e-10  29%  3c57A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-09  26%  3c57B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-07  25%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-07  25%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-07  24%  3cloC  [x.x.x] TRANSCRIPTIONAL REGULATOR
    1e-05  16%  1co0A  [a.4.12] TRP OPERON REPRESSOR
    2e-05  24%  2d9sA  [x.x.x] CBL E3 UBIQUITIN PROTEIN LIGASE
    8e-04  19%  2cg4A  [x.x.x] REGULATORY PROTEIN ASNC
:520

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYGLTPRERELLGFFAQGYSVAYASEQLVLS
3cloA           ------------------------------------------LSEREKEILRCIRKGLSSKEIAATLYIS
3c57A           -----------------------------------------GLTDQERTLLGLLSEGLTNKQIADRMFLA
3c57B           -------------------------------------------TDQERTLLGLLSEGLTNKQIADRMFLA
3c3wA           ------------------------------------------LTDQERTLLGLLSEGLTNKQIADRMFLA
3c3wB           ------------------------------------------LTDQERTLLGLLSEGLTNKQIADRMFLA
3cloC           -------------------------------------------------------KGLSSKEIAATLYIS
1co0A           ------------------------------------------LGTRVRIVEELLRGEMSQRELKNELGAG
2d9sA           ------------------------------------------------EIERLMSQGYSYQDIQKALVIA
2cg4A           ----------------------------------------YLIDNLDRGILEALMGNTAYAELAKQFGVS


                         *         .         .         .         .         +         .:560
query           PYTVRTHLRNIYVKTDTHSRDDLLALLKxx
3cloA           VNTVNRHRQNILEKLSVGNSIEACRA----
3c57A           EKTVKNYVSRLLAKLGMERR----------
3c57B           EKTVKNYVSRLLAKLGMERR----------
3c3wA           EKTVKNYVSRLLAKLGMERRTQAAV-----
3c3wB           EKTVKNYVSRLLAKLGMERRTQAAV-----
3cloC           VNTVNRHRQNILEKLSVGNSIEACRA----
1co0A           IATITRGSNSLK-AAPVELRQWLEEVLL--
2d9sA           HNNIEMA-KNILREFSGPSS----------
2cg4A           PETIHVRVEKMK------------------