[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV54563.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cloA.bssp"
#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "3c57A.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "3c57B.bssp"
#ERROR : Can't open dsspfile "1co0A.bssp"
#ERROR : Can't open dsspfile "3cloC.bssp"
#ERROR : Can't open dsspfile "2d9sA.bssp"
#ERROR : Can't open dsspfile "2cg4A.bssp"
#ERROR : Can't open dsspfile "3boqA.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "3boqB.bssp"
#ERROR : Can't open dsspfile "2efnA.bssp"

## Summary of PDB Search
:474
    4e-12  19%  3cloA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    4e-09  20%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    4e-09  22%  3c57A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-08  20%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-08  18%  3c57B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-08  21%  1co0A  [a.4.12] TRP OPERON REPRESSOR
    9e-08  25%  3cloC  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-06  29%  2d9sA  [x.x.x] CBL E3 UBIQUITIN PROTEIN LIGASE
    1e-05  16%  2cg4A  [x.x.x] REGULATORY PROTEIN ASNC
    3e-05  17%  3boqA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    6e-05  17%  1dpuA  [a.4.5] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    2e-04  33%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    3e-04  15%  3boqB  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    7e-04  11%  2efnA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
:474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
3boqB           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
3boqB           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
3boqB           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
3boqB           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cloA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3c57A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
1co0A           ----------------------------------------------------------------------
3cloC           ----------------------------------------------------------------------
2d9sA           ----------------------------------------------------------------------
2cg4A           ----------------------------------------------------------------------
3boqA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
3boqB           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMLGRIGLKAPAERERESTPAAAAHALAERYGLTAREAE
3cloA           --------------------------------DQRPEQGIYATITQERGEVETLSLSEEHRNILSEREKE
3c3wB           -----------------------------------------------------AAEKQDPLSGLTDQERT
3c57A           --------------------------------------------------------------GLTDQERT
3c3wA           -----------------------------------------------------AAEKQDPLSGLTDQERT
3c57B           ----------------------------------------------------------------TDQERT
1co0A           ----------------------------------------------------------DEREALGTRVRI
3cloC           ----------------------------------------------------------------------
2d9sA           --------------------------------------------------------------------SE
2cg4A           -------------------------------------------------------------YLIDNLDRG
3boqA           ---------------------------------------------------GDLNRQLLDETGLSLAKFD
1dpuA           -------------------------------------------------------------NGLTVAQNQ
1a04A           ------------------------------------------------------------------RERD
3boqB           ----------------------------------------------------DLNRQLLDETGLSLAKFD
2efnA           ---------------------------------------------------------------MDEIDLR


                         .         .         +         .         .         .         .:490
query           VLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKLDVHSREELIDLVQEExxx
3cloA           ILRCIRKGLSSKEIAATLYISVNTVNRHRQNILEKLSVGNSIEACRAAEL----
3c3wB           LLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFA------
3c57A           LLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ-----------
3c3wA           LLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFA------
3c57B           LLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ-----------
1co0A           VEELLRGEMSQRELKNELGAGIATITRGSNSL-KAAPVELRQWLEEVLLK----
3cloC           ------KGLSSKEIAATLYISVNTVNRHRQNILEKLSVGNSIEACRAAEL----
2d9sA           IERLMSQGYSYQDIQKALVIAHNNIEMAKN-ILREFSGPSS-------------
2cg4A           ILEALMGNARTAYAEKQFGVSPETIHVRVEKMKQAGIITGARIDVS--------
3boqA           AAQLARNPGLSGKLSGALKVTNGNVSGLVNRLIKDGVVKAF-------------
1dpuA           VLNLIKAPRPEGLNFQDLKMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD---
1a04A           ILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAA---------
3boqB           AALARNPDGLSGKLSGALKVTNGNVSGLVNRLIKDGVVKAS-------------
2efnA           ILKILQYNAKYSLDEREIRIPKATLSYRIKKLEKDGVIKGYYAYIN--------