[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV54981.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "2czdB.bssp"
#ERROR : Can't open dsspfile "3clmA.bssp"
#ERROR : Can't open dsspfile "2d1vA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "3bulA.bssp"
#ERROR : Can't open dsspfile "3cnbC.bssp"
#ERROR : Can't open dsspfile "2cz5A.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "3cz5A.bssp"
#ERROR : Can't open dsspfile "3b2nA.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "1dcmA.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "3cz5C.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "3cnbA.bssp"
#ERROR : Can't open dsspfile "2czdA.bssp"
#ERROR : Can't open dsspfile "1bmtA.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "1ec7D.bssp"
#ERROR : Can't open dsspfile "2c15A.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "1e51A.bssp"
#ERROR : Can't open dsspfile "2a1hA.bssp"
#ERROR : Can't open dsspfile "3c97A.bssp"
#ERROR : Can't open dsspfile "2a1tS.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "1aw5A.bssp"
#ERROR : Can't open dsspfile "3crnA.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "2a9qA.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "2b4aA.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "1e6mA.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "3cg4A.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "1bknA.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "1bqgA.bssp"
#ERROR : Can't open dsspfile "1ab6A.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "1be1A.bssp"
#ERROR : Can't open dsspfile "1e6lA.bssp"
#ERROR : Can't open dsspfile "1b1aA.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "3c3mA.bssp"
#ERROR : Can't open dsspfile "3crnB.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "2c19B.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "2d00A.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "6chyA.bssp"
#ERROR : Can't open dsspfile "1ccwA.bssp"
#ERROR : Can't open dsspfile "3b8mC.bssp"
#ERROR : Can't open dsspfile "1b62A.bssp"
#ERROR : Can't open dsspfile "2dvpA.bssp"
#ERROR : Can't open dsspfile "1ea6B.bssp"
#ERROR : Can't open dsspfile "2c13B.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "2chuA.bssp"
#ERROR : Can't open dsspfile "1ec9D.bssp"
#ERROR : Can't open dsspfile "3dqqB.bssp"
#ERROR : Can't open dsspfile "2c13A.bssp"
#ERROR : Can't open dsspfile "2c16A.bssp"
#ERROR : Can't open dsspfile "1ec9A.bssp"
#ERROR : Can't open dsspfile "1ea6A.bssp"
#ERROR : Can't open dsspfile "1eb3A.bssp"
#ERROR : Can't open dsspfile "1e1cA.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "1e32A.bssp"
#ERROR : Can't open dsspfile "2c14B.bssp"
#ERROR : Can't open dsspfile "1dv7A.bssp"
#ERROR : Can't open dsspfile "3b8nA.bssp"
#ERROR : Can't open dsspfile "2c18B.bssp"
#ERROR : Can't open dsspfile "2c15B.bssp"
#ERROR : Can't open dsspfile "3e2iA.bssp"
#ERROR : Can't open dsspfile "2dvyF.bssp"
#ERROR : Can't open dsspfile "1d2iB.bssp"
#ERROR : Can't open dsspfile "3dzdA.bssp"
#ERROR : Can't open dsspfile "1a5aA.bssp"
#ERROR : Can't open dsspfile "2dvyD.bssp"
#ERROR : Can't open dsspfile "2dvyB.bssp"
#ERROR : Can't open dsspfile "1a2oA.bssp"
#ERROR : Can't open dsspfile "1d2iA.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "3bijA.bssp"
#ERROR : Can't open dsspfile "2dvyC.bssp"
#ERROR : Can't open dsspfile "1ec7A.bssp"

## Summary of PDB Search
:235
    3e-32  17%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-30  20%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    4e-28  10%  2czdB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    6e-27   7%  3clmA  [x.x.x] TRANSALDOLASE
    1e-26  34%  2d1vA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN YYCF
    6e-26  21%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    7e-25  10%  3bulA  [x.x.x] METHIONINE SYNTHASE
    6e-24  21%  3cnbC  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    7e-24  10%  2cz5A  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    8e-24  28%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    9e-24  28%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    1e-23  33%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    2e-23  24%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    6e-23  36%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    6e-23  24%  3cz5A  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    6e-23  20%  3b2nA  [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
    2e-22  23%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-22  35%  3dgeC  [x.x.x] RESPONSE REGULATOR
    2e-22  23%  1dcmA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-22  23%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    3e-22  25%  3cz5C  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-22  29%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    5e-22   9%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    8e-22  24%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    1e-21  23%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-21  21%  3cnbA  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    1e-21  10%  2czdA  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-21  11%  1bmtA  [a.46.1 - c.23.6] METHIONINE SYNTHASE
    4e-21  30%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    6e-21  22%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    7e-21  23%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    7e-21  24%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    8e-21  10%  1ec7D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-20  14%  2c15A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-20  20%  1dcfA  [c.23.1] ETR1 PROTEIN
    3e-20  34%  3dgfC  [x.x.x] RESPONSE REGULATOR
    3e-20  40%  2a9oA  [x.x.x] RESPONSE REGULATOR
    3e-20   9%  1b63A  [d.122.1 - d.14.1] MUTL
    4e-20  14%  1e51A  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    4e-20   9%  2a1hA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE
    5e-20  21%  3c97A  [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
    6e-20  15%  2a1tS  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    7e-20  28%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-19  11%  1aw5A  [x.x.x] 5-AMINOLEVULINATE DEHYDRATASE
    1e-19  22%  3crnA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    1e-19  24%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    2e-19  36%  2a9qA  [x.x.x] RESPONSE REGULATOR
    2e-19  19%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    4e-19  22%  2b4aA  [x.x.x] BH3024
    5e-19  19%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    5e-19  28%  1cyeA  [x.x.x] CHEY
    5e-19  28%  1e6mA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    6e-19  25%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    1e-18  21%  3cg4A  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
    1e-18  28%  5chyA  [x.x.x] CHEY
    1e-18  12%  1bknA  [d.122.1 - d.14.1] MUTL
    1e-18  28%  3chyA  [c.23.1 (1a0oA)] CHEY
    2e-18  11%  1bqgA  [x.x.x] D-GLUCARATE DEHYDRATASE
    2e-18  29%  1ab6A  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    2e-18  28%  1ab5A  [c.23.1] CHEY
    3e-18   8%  1be1A  [c.23.6 (1fmfA)] GLUTAMATE MUTASE
    4e-18  28%  1e6lA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    5e-18   8%  1b1aA  [x.x.x] GLUTAMATE MUTASE
    6e-18  28%  1chnA  [x.x.x] CHEY
    7e-18  15%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    9e-18  24%  3c3mA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    9e-18  24%  3crnB  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    9e-18  27%  1ehcA  [x.x.x] CHEY
    1e-17  28%  2cheA  [x.x.x] CHEY
    1e-17  17%  2c19B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-17  11%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    3e-17  28%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    3e-17  22%  2d00A  [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT F
    5e-17  14%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    6e-17  28%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    6e-17  28%  6chyA  [c.23.1] CHEY
    8e-17  10%  1ccwA  [c.23.6] PROTEIN (GLUTAMATE MUTASE)
    8e-17  13%  3b8mC  [x.x.x] FERRIC ENTEROBACTIN (ENTEROCHELIN) TRANSPORT
    8e-17  12%  1b62A  [d.122.1 - d.14.1] PROTEIN (MUTL)
    3e-16   9%  2dvpA  [x.x.x] HYPOTHETICAL PROTEIN PH1917
    4e-16   8%  1ea6B  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    6e-16  12%  2c13B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    8e-16  32%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    1e-15   6%  2chuA  [x.x.x] ENTEROCHELIN UPTAKE PERIPLASMIC BINDING PROTEIN
    1e-15   9%  1ec9D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    1e-15  14%  3dqqB  [x.x.x] PUTATIVE TRNA SYNTHASE
    2e-15  14%  2c13A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    4e-15  13%  2c16A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    4e-15  10%  1ec9A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    9e-15   8%  1ea6A  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    9e-15  19%  1eb3A  [c.1.10] 5-AMINOLAEVULINIC ACID DEHYDRATASE
    2e-14  14%  1e1cA  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE ALPHA CHAIN
    2e-14  34%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    3e-14   7%  1e32A  [b.52.2 - d.31.1 - c.37.1] P97
    3e-13  13%  2c14B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    4e-13  12%  1dv7A  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    5e-13  13%  3b8nA  [x.x.x] FERRIC ENTEROBACTIN (ENTEROCHELIN) TRANSPORT
    1e-12  16%  2c18B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-12  15%  2c15B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-11  17%  3e2iA  [x.x.x] THYMIDINE KINASE
    6e-11   9%  2dvyF  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    2e-10  11%  1d2iB  [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BGLII)
    3e-10  20%  3dzdA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    1e-09  12%  1a5aA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    2e-08   2%  2dvyD  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    5e-08  12%  2dvyB  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    8e-08  13%  1a2oA  [c.23.1 - c.40.1] CHEB METHYLESTERASE
    2e-07  10%  1d2iA  [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BGLII)
    4e-06  32%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    6e-06  16%  3bijA  [x.x.x] UNCHARACTERIZED PROTEIN GSU0716
    1e-04  14%  2dvyC  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    3e-04  11%  1ec7A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDGFTTCRLMRER
3c3wB           MVKVFLVDDHEVVRRGLVDLLGADPELDGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSR
3c3wA           MVKVFLVDDHEVVRRGLVDLLGADPELDGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSR
2czdB           ------------------------------VYEGERAIKIAKSVKDYISMIKVNWPLGSGVDIIRRLKEE
3clmA           -HESTGGKTGFVSLEV------SPELAKDAQGTVEEARRLHAAI--ARKNAIKVPATDAGIDALETLVSD
2d1vA           ----------------------------------------------------------------------
3cwoX           ---------------------GKRVLIVDDATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKI
3bulA           VIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKIKEVNADLIGLSGLITPSLDEMVNVAKEMER
3cnbC           --SILIIEDDKEFADMLTQFNLFPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFSICHRIKST
2cz5A           ------------------------------VYEGERAIKIAKSVKDYISMIKVNWPLILGSGVDIIRRLK
3cfyA           -PRVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLDWINQN
1dc7A           RGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQR
1b00A           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
3cz5B           --RIMLVDDHPIVREGYRRLIERRPAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIEATRHIRQW
2a9rA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFE-AEQPDIIILLMLPEIDGLEVAKTIRKT
3cz5A           --RIMLVDDHPIVREGYRRLIERRPAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIEATRHIRQW
3b2nA           LTSLIIAEDQNMLRQAMVQLIKLHGDFEADTDNGLDAMKLIEEYNPNVVILDIEMPGMTGLEVLAEIRKK
1dbwA           -YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDL
3dgeC           MSKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEE
1dcmA           -YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDL
1d5wA           -YTVHIVDDEEPVRKSLAFMLTMNGFAV-KMHQSAEAFLAFAPDVRNGVLVTLRMPDMSGVELLRNLGDL
3cz5C           --RIMLVDDHPIVREGYRRLIERRPAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIEATRHIRQW
2ayxA           DMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQL
3c2eA           IISLARSTGYKGTIAGTRKTTPGLRRLEKYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARA
3cu5B           --RILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAALKHPPNVLLTDVRMPRMDGIELVDNILKL
1d5wB           -YTVHIVDDEEPVRKSLAFMLTMNGFAV-KMHQSAEAFLAFAPDVRNGVLVTLRMPDMSGVELLRNLGDL
3cnbA           --SILIIEDDKEFADMLTQFNLFPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFSICHRIKST
2czdA           ------------------------------VYEGERAIKIAKSVKDYISMIKVNWPLILGVDIIRRLKEE
1bmtA           VIATVKGDVHDIGKNIVGVVLQCNNYELGVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVAKGFT
2ayzA           --MILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQL
1c4wA           --KFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRAD
1dbwB           -YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDL
3cu5A           --RILIVDDEKLTRDGLIANINWKALSFDQIDQADDGIQIALKHPPNVLLTDVRMPRMDGIELVDNILKL
1ec7D           KGGVLAGEEEAESIVALAQRFPQARITLNGAWSLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEF
2c15A           ------PFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAAD--LAEGADMVMVPGMPYLDIVRRVKDE
1dcfA           --KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHE-HKVVFMDVCMPGVENYQIALRIHEK
3dgfC           -KKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEK
2a9oA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIR-K
1b63A           DVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFL--EQALAIEWQHGDLTLRGWVADPNHTTPALA
1e51A           YSAKFASCFYGPFRDAAKSSFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDK
2a1hA           -----------------------------FPGGSVTPVSLLARAWVGGVNYKLGGNYGPTVLVQQEALKR
3c97A           --SVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLEAVSEIRNY
2a1tS           ---IAVSCGPAQCQEIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGF
1d4zA           --KFLVVDDFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRGA
1aw5A           ---CVAPSDIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGSEGADGIIVKPSTFYLDIVRDASEI
3crnA           LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLPDEGTELL----EKAH
1dc8A           RGIVWVVDDDSSIRWVLERALAGAGLTC-TTFENGNEVLAALASKTPDVLLSIRMPGMDGLALLKQIKQR
2a9qA           -KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREA-----LEQFEAEQPDIIILDLDGLEVAKTIRKT
3cg0B           LPGVLIVEDGRLAAATLRIQLESLGYDLGVFDNGEEAVRCAPDLRPDIALVDIMLCGALDGVETAARLAA
2b4aA           --RVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQRSQLSTCDLLIVSDQLVDLSIFSLLDIVKEQ
3cg0A           LPGVLIVEDGRLAAATLRIQLESLGYDLGVFDNGEEAVRCAPDLRPDIALVDIMLCGALDGVETAARLAA
1cyeA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1e6mA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRAD
1dz3A           --KVCIADDNRELVSLLDEYISSQPDMEGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVLERIRAG
3cg4A           -KGDVIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIPGDGWD---TIRAILDN
5chyA           --KFLVVDDFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1bknA           DVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEI
3chyA           --KFLVVDDFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIDGA
1bqgA           KGGVLRGEDEIAAVTALSERFPDARITLNGAWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGREVMAEF
1ab6A           --KFLVVDDNSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1ab5A           --KFLVVDDNSTMRRITRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRGA
1be1A           VLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEAAIETKADLICVSSLYGQGEIDCKGLREKCDE
1e6lA           --KFLVVDAFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1b1aA           VLGVIGSDCHAVGNKILDHAFTNAGFNIGVLSPQEVFIKAAIETKADALLSSLYGQGEIDCKGLRQKCDE
1chnA           --KFLVVDDFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1e51B           ------MSYSAKFASCFYGPFRDAARRCLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDK
3c3mA           LYTILVVDDSPIVDVFV--TLERGGYRPITAFSGEECLEALNATPPDLVLLDIEPDGWETLERIKTDPAT
3crnB           LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLPD-EGTELLEKAHKLR
1ehcA           --KFLVVDKFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
2cheA           --KFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRAD
2c19B           ------------FRDAVGSAGNKATYQMDPANSDEALHEVAADL-AEGADMVMVKPGMPYLDIVRRVKDE
2ch4B           NIDTILSISKEDIQRVQDRDVIVIRGEVIPVYWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQD
1e6kA           --KFLVVADFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
2d00A           -VRMAVIADPETAQGFR--LAGLEGYGASSAEEAQSLLTLVERGGYALVAVDEALLPDPERAVERLMRGR
2ch4A           NIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEEEMEAVIVRVGNRKYGIVVDDLLGQD
1djmA           --KFLVVDDFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
6chyA           --KFLVVDDFSTMRRIVRNLLKELGFNNEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRGA
1ccwA           VLGVIGSDCHAVGNKILDHAFTNAGFNIGVLSPQELFIKAAIETKADAILVSSLYGEIDCKGLRQKCDEA
3b8mC           --EIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYDDPDFSSLGADGIERKLEIE-K
1b62A           --TINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEI
2dvpA           ------------------------------PGKVREVANFLGTFGIEIVQLKHEYPEIQAEKLEDVVDFG
1ea6B           GIRVSCTNQLGQGKRQPVVCTGGSPSIKENQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGF
2c13B           ---------GPFRDAVGSASGNKATYQMDPANSDEALH---EVAADLAEGADMVMVPGMPYLDIVRRVKD
3breB           --MVLLVDDQAMIGEAVRRSLASEAIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLLAAYRGN
2chuA           -----------GPQSRFGIIHDVLGINAVDENIKGKNSEFILEKNPDYIFVVDRNVILGNKERAQGILDN
1ec9D           KGGVLAGEEEAESIVALAQRFPQARITLNGAWSLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEF
3dqqB           MLKIGVIADDFTGATDIASFLVENGMPTVQINDVPTGTQPEGCDAVVISLKTRSCPAQEAIKQSLAALVK
2c13A           ------PFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAAD--LAEGADMVMVPGMPYLDIVRRVKDE
2c16A           ------------------------ATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIVRRVKDE
1ec9A           -------EEEAESIVALAQRFPQARITLNGAWSLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEF
1ea6A           ------------------------IGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGF
1eb3A           ----------------------------------------DMSEGADGIIVK---PSTFYLDIMRDASEI
1e1cA           --RILLADGHDRGQKVIATAYADLGFVGPLFQTPEETARQAVEADVHVVGVSSLAGGHLTLALRKELDKL
3breA           --MVLLVDDQAMIGEAVRRSASEAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLLAAYRGN
1e32A           -------------------------IQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPI
2c14B           ----------------------------------------VAADLAEGADMVMVKPGMPYLDIVRRVKDE
1dv7A           ------------------------------LMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFR
3b8nA           ---IKTQFEKEKLAQDRIKMKNQLDANI---QRLNYSLDIANAAGIKKPVYDPDFSISLGADGIERKLEK
2c18B           ------------PFRDAVGSANKATYQMDPANSDEALHEVAAD--LAEGADMVMVPGMPYLDIVRRVKDE
2c15B           -------------PFRDAVGSNKATYQMDPANSDEALHEVAAD--LAEGADMVMVPGMPYLDIVRRVKDE
3e2iA           ------------IRRLRRGIYAKQKVVVFKPAHNGNAIEAINISKASEITHDLTNVDVIGIDEVQFFDDE
2dvyF           --AKKELPSGEFIGIVLKVGYQSMVYVCIPLTNVEPSLAGRVARRNEVVKYDLMKELLKAFIIASETHKN
1d2iB           ----------------------------------------------------------------------
3dzdA           -KRVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKELFFPVIVLDVWPD-GDGVNFIDFIKEN
1a5aA           ---------------------------------VFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQA
2dvyD           CIPLTNVEPSLAGRVARRNEVVKYEVPVDLMKELLKAFIIASETHKNDIVKFL-----------------
2dvyB           -----------------------------CIPLTNVEPSLAGRVANEVVKYEVPVDLMKELLKAFIIASE
1a2oA           --RVLSVDDSALMRQIMTEIINSHSDMEATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFLEKLMRV
1d2iA           ----------------------------------------------------------------------
1a04A           --TILLIDDHPMLRTGVKQLISMAPDITGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
3bijA           --------------------------LNACEADAEDAAIAAERGFAVTTLTKAATRAKVIDAIGKAAKAL
2dvyC           --YPVAKKE-LPSGEFIGIVLKHGYQSMVYVCIPLTNVEPSGRVANEVVKYEVMKELLKAF---IIASE-
1ec7A           ---------------------------PNGAWSLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEF


                         .         .         *         .         .         .         .:140
query           GITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIEAHLRRASMAAAPVAPRGDILHAGRFV
3c3wB           MPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDN---------RAAAAL
3c3wA           MPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAA-------AALMA
2czdB           TGVEIIADDIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFNPLTDRF
3clmA           GISVNLTLLFSRAQTLKAYAAYARGIAKRLAAGQSVAHIQVVASFFISRVDSALDATL-------PDRLK
2d1vA           -------------------------------------------------------------NEIHIGSLV
3cwoX           DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVNTAAVENPSLITQIAQTFGSQAVVVAIDA----------
3bulA           IPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETVPRTPPVT
3cnbC           PATIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQLVEQ---------------------
2cz5A           IIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPTDRF
3cfyA           DIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKL------------------
1dc7A           HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHY--------------------
1b00A           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
3cz5B           DGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSPDIAQE----------
2a9rA           SSVP-ILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS--------------------
3cz5A           DGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSPDIAQE----------
3b2nA           HLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVN-----------------------
1dbwA           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH---------------------
3dgeC           WKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN----------------------
1dcmA           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH---------------------
1d5wA           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH---------------------
3cz5C           DGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSPDIA------------
2ayxA           GLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAERVRKS-----------------
3c2eA           VCGFAVKIEVECLSEDEATEAIEAGADVIMLDNHFLLECSGGLNLLCDDIDIYSTSSIHQG--TPVIDFS
3cu5B           YPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPSEIMDALKQSIQTVLQHQA---------------
1d5wB           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH---------------------
3cnbA           PATIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQLVEQK--------------------
2czdA           TGVDLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFINPTDRF
1bmtA           IPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETV-------
2ayzA           GLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAERVRK------------------
1c4wA           GAMLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1dbwB           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHL--------------------
3cu5A           YPDCSVIF------MSGYSDKEYLRAIRYVEKPIDPSEIMDALKQSIQTVLQHQA---------------
1ec7D           ATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAM
2c15A           -FRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGILTYFAKQA---------------
1dcfA           HQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVL------------------
3dgfC           EEWKRIIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLL-----------------------
2a9oA           TSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR---------------------
1b63A           -EIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQV---------------------
1e51A           HPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYT-----------------
2a1hA           GC-EQVLWLYGPDHQLTEVGTHEDGVLELVTPPLNGVILPGVVRQSLL----------------DMAQTW
3c97A           ERTHNTKRAAITADTIDDD-RPGAELDEYVSKPLNPNQLRDVVLTCH-----------------------
2a1tS           LDWPQGTFASQVTLEGDKLKVERADGGLETLRLKLPAVVTADLRLNEPRATLPNIMKAKKKEVIKPGDLG
1d4zA           MSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1aw5A           CKDLPICAYHVSGEYAL----HAAAEKGVVDLKTIAFESHQGFLRAGARL--------------------
3crnA           KLRPGKKIVTGYASLENSVFSLNAGADAY-IKPVNPRDLLEKIKEKLDEQEKEGH---------------
1dc8A           HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHY--------------------
2a9qA           -SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR---------------------
3cg0B           GCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMAIHKKKL------------------
2b4aA           TKQPSVLILTTGRLI-----ESSEHNLSYLQKPFAISELRAAIDYHKP----------------------
3cg0A           GCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMAIHKKKL------------------
1cyeA           GAMSALLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1e6mA           GAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1dz3A           FEQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGK---------------------
3cg4A           SLEQGIAIVLTAKNAPDAKIGLQEYVVDYITKPFDNEDLIEKTTFFGFV---------------------
5chyA           GAMSAVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM------------------
1bknA           ---QYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVL------------------------------
3chyA           MSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1bqgA           RRSLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSFDISLAMFTH
1ab6A           GAMLPVLMTTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1ab5A           MSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1be1A           AGLKGIKLVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLG----------------------
1e6lA           GAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1b1aA           AGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNI---------------------
1chnA           GAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1e51B           HPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYT-----------------
3c3mA           RDIPV--LLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLAR---------------------
3crnB           ---PGKKIVTGYASLENSVFSLNAGADAY-IKPVNPRDLLEKIKEKLDEQEKEG----------------
1ehcA           GAMSALPVVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
2cheA           SSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
2c19B           -FRAPTFVYQVSGEYAMH---MGAIQNGWLAESVILESLTAFKRAGADGILTYFAK--------------
2ch4B           --DIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV------------------------------
1e6kA           GSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
2d00A           DLPV--LLPIAGLKEAFQGHDVEGYMRELVRKTIGFDIKL------------------------------
2ch4A           DIVI--KSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV------------------------------
1djmA           GAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
6chyA           MSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM------------------
1ccwA           GLEGILLYVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNI---------------------
3b8mC           AVTDVAELNGERQYLVEQLTKANINDVNYQLSPSLP----------------------------------
1b62A           QYRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHKHE---------------------
2dvpA           ISWLKGKMIEDSGLFIESLKGFPGVYSSYVYRTIGLEGILKLMEGAEDRRAYFKSVIGFYIDGKAYKFSG
1ea6B           ISQCTHGVGRSS---------TDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFV------------
2c13B           EFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGILTYFAKQA---------------
3breB           PATRPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYHSRS---------------------
2chuA           ALVAKAAIIYLDPEYWYLASGNGLESLKTMILEIKN----------------------------------
1ec9D           RRALPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAM
3dqqB           KQGCQQVYFKYCSTFDSTAEGNIGPVTDALMVALDTSFTVISPALP------------------------
2c13A           F-RAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAG---------------------------
2c16A           -FRAPTFVYQVSGEYAMHMGAIQNGWLA---ESVILESLTAFKRAGADGILTYFAK--------------
1ec9A           RRATPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISL--
1ea6A           ISQCTHGVGRS---------STDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFV------------
1eb3A           CKDLPICAYHVSGEYAMLHAAAEKGVVDL--KTIAFESHQGFLRAGARLIITYLAP--------------
1e1cA           GRPDILITVGGVIPEQDFDELRKDGAVEIYTPGTVIPESAISLVKKLRASLDA-----------------
3breA           PATRDIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYHSRS---------------------
1e32A           RKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESL------------------
2c14B           -FRAPTFVYQVSGEYAMH---MGAIQNGWLAESVILESLTAFKRAGADGILTYFAKQAAE----------
1dv7A           IIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHIQGAADEI
3b8nA           AVTDVAELNGERQYLVEQLTKANINDVNYQLSPSLP----------------------------------
2c18B           -FRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGILTYFAKQA---------------
2c15B           -FRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGILTYFAKQA---------------
3e2iA           IVSI-VEKLSADGHR-----VIVAGLDDFRGEPFEPPKLAVSEQTKLQAVCAVCGSSSSRTQRLINGKPA
2dvyF           ----DIVKFLRS----------------------------------------------------------
1d2iB           --------------------ITDYNHADEILNPQLWKEIEETLLKPLHVKASDQASKVGSLIFDPVGTN-
3dzdA           SPDSVVIVITGHGSVDTAVKAIKKGAYEFL----------------------------------------
1a5aA           ALRIAPIFICPPNADDDLLRQVASYGRGYTYLALPLHHLIEKLKEYHAA---------------------
2dvyD           ----------------------------------------------------------------------
2dvyB           THKNDIV---------------------------------------------------------------
1a2oA           MVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYSEMIAEKVRTAARARIAAHKPMAAPTTLKAG
1d2iA           --------------------ITDYNHADEILNPQLWKEIEETLLKPLHVKAS--------DQASKVGSLI
1a04A           SLSGRIVV--------------------------------------------------------------
3bijA           GKGDIFLSYSGHGGQVPDTSNDEPDGVDETWCLFDGELIDDELYAL------------------------
2dvyC           ----------------------------------------------------------------------
1ec7A           RRATPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVA-QMCHEFGLTWGSHS---------


                         +         .         .         .         .         *         .:210
query           LDRGQFRVTKDGERLSLTPKEFKIFFALASSPGLVLSKEQLVEAAWGKEFVGETSSITVFIKKLREKVED
3c3wB           MAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQ---------IADRMFLAEKTVKNYVSRLLAKLGM
3c3wA           KLRGAAEK--QDPLSGLTDQERTL---------LGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGM
2czdB           IEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNP
3clmA           GKTAIALAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKN---------PAYPDTLYVDSLIGV
2d1vA           IFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIED
3cwoX           ----------------------------------------------------------------------
3bulA           LEAARDNDFAFDWQAYTPPVAHRLGVQEVEASIETLIDWTPFFMTWSLAGKYPRILEDEVVGVEAQRFKD
3cnbC           ----------------------------------------------------------------------
2cz5A           IEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNP
3cfyA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3c2eA           LK--------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
2czdA           IEVANEIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIGAQGGKAKDAVKAGADYIIVGRAIYNAPNP
1bmtA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1ec7D           FTHVAAAAPGKITAIDTHWIWQEGNQRLTKEPFEIKGGLVQVPEKPGLGVEIDMDQVMKAHE-LYQKHGL
2c15A           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
2a1hA           GEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKE
3c97A           ----------------------------------------------------------------------
2a1tS           VDLTSKLSVISVED---PPTTEDL----------------------------------------------
1d4zA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           VAAAA-PGNITAI--DTHWIW-------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2dvpA           VTWGR-------ISNEKRGTHGFGYDPIFIPEGSEKTFAEMT-IEEKNALSHRGKALKAFFEWLKVNL--
1ea6B           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ec9D           FTHVAAAAPGKITAIDTHWIWQEGNQRLTKEPFEIKGGLVQVPEKPGLGVEIDMDQVMKAHELYQKH---
3dqqB           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
1dv7A           ARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGETLRFADA-----------------------
3b8nA           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
3e2iA           KIDDP-----------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
1d2iB           -------QYIKDELVPKHWKNNIPIPKRFDFLGTDIDFGKRDTLVEVQFSNYPFLLNNTVRSELFHKSND
3dzdA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1a2oA           PLLSSEKLIAIGASTGGTEAIRHVLQPLPLSSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERV
1d2iA           FDPVGTNQYIKDELVPKHWKNNIPIPKRFDFLGTDIDFGKRDTLVEVQFSNYPFLLNNTVRSELFKSNDI
1a04A           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DPSDPRVIQTVWGIGYRFEPEGREx
3c3wB           E-RRTQAAVFATELKR---------
3c3wA           E-RRTQAAVFATELKR---------
2czdB           REAAKAIYDEIRG------------
3clmA           HTVNDATLKAFIDHGTTLTESADE-
2d1vA           NPSHPNWIVTRRGVGYYLRN-----
3cwoX           -------------------------
3bulA           ANDMLDKLSAEKTLNPRG-------
3cnbC           -------------------------
2cz5A           REAAKAIYDEIRGV-----------
3cfyA           -------------------------
1dc7A           -------------------------
1b00A           -------------------------
3cz5B           -------------------------
2a9rA           -------------------------
3cz5A           -------------------------
3b2nA           -------------------------
1dbwA           -------------------------
3dgeC           -------------------------
1dcmA           -------------------------
1d5wA           -------------------------
3cz5C           -------------------------
2ayxA           -------------------------
3c2eA           -------------------------
3cu5B           -------------------------
1d5wB           -------------------------
3cnbA           -------------------------
2czdA           REAAKAIYDEI--------------
1bmtA           -------------------------
2ayzA           -------------------------
1c4wA           -------------------------
1dbwB           -------------------------
3cu5A           -------------------------
1ec7D           GARDDAMGMQYLIPGWTFDNKR---
2c15A           -------------------------
1dcfA           -------------------------
3dgfC           -------------------------
2a9oA           -------------------------
1b63A           -------------------------
1e51A           -------------------------
2a1hA           -------------------------
3c97A           -------------------------
2a1tS           -------------------------
1d4zA           -------------------------
1aw5A           -------------------------
3crnA           -------------------------
1dc8A           -------------------------
2a9qA           -------------------------
3cg0B           -------------------------
2b4aA           -------------------------
3cg0A           -------------------------
1cyeA           -------------------------
1e6mA           -------------------------
1dz3A           -------------------------
3cg4A           -------------------------
5chyA           -------------------------
1bknA           -------------------------
3chyA           -------------------------
1bqgA           -------------------------
1ab6A           -------------------------
1ab5A           -------------------------
1be1A           -------------------------
1e6lA           -------------------------
1b1aA           -------------------------
1chnA           -------------------------
1e51B           -------------------------
3c3mA           -------------------------
3crnB           -------------------------
1ehcA           -------------------------
2cheA           -------------------------
2c19B           -------------------------
2ch4B           -------------------------
1e6kA           -------------------------
2d00A           -------------------------
2ch4A           -------------------------
1djmA           -------------------------
6chyA           -------------------------
1ccwA           -------------------------
3b8mC           -------------------------
1b62A           -------------------------
2dvpA           -------------------------
1ea6B           -------------------------
2c13B           -------------------------
3breB           -------------------------
2chuA           -------------------------
1ec9D           -------------------------
3dqqB           -------------------------
2c13A           -------------------------
2c16A           -------------------------
1ec9A           -------------------------
1ea6A           -------------------------
1eb3A           -------------------------
1e1cA           -------------------------
3breA           -------------------------
1e32A           -------------------------
2c14B           -------------------------
1dv7A           -------------------------
3b8nA           -------------------------
2c18B           -------------------------
2c15B           -------------------------
3e2iA           -------------------------
2dvyF           -------------------------
1d2iB           I------------------------
3dzdA           -------------------------
1a5aA           -------------------------
2dvyD           -------------------------
2dvyB           -------------------------
1a2oA           LPGHAY-IAPGDKHMELARSGANY-
1d2iA           DEEGKVAIIITKGHFPAS-------
1a04A           -------------------------
3bijA           -------------------------
2dvyC           -------------------------
1ec7A           -------------------------