[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55062.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2biiA.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "2a9aB.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "2ca3A.bssp"
#ERROR : Can't open dsspfile "2bihA.bssp"
#ERROR : Can't open dsspfile "2a9aA.bssp"
#ERROR : Can't open dsspfile "2a99A.bssp"

## Summary of PDB Search
:359
    3e-19  22%  2a9cA  [x.x.x] SULFITE OXIDASE
    1e-17  22%  2biiA  [x.x.x] NITRATE REDUCTASE [NADPH]
    3e-17  23%  2a9dB  [x.x.x] SULFITE OXIDASE
    1e-16  22%  2a9aB  [x.x.x] SULFITE OXIDASE
    3e-13  22%  2a9dA  [x.x.x] SULFITE OXIDASE
    6e-11  25%  2ca3A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    3e-08  21%  2bihA  [x.x.x] NITRATE REDUCTASE [NADPH]
    4e-05  18%  2a9aA  [x.x.x] SULFITE OXIDASE
    0.001  15%  2a99A  [x.x.x] SULFITE OXIDASE
:359

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2a9cA           ----------------------------------------------------------------------
2biiA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
2bihA           ----------------------------------------------------------------------
2a9aA           ----------------------------------------------------------------------
2a99A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxAFTFNQEGVTPNDELFNVFGTALTSMCSKPATELVDVEGGVANFYVNVGGNIKKNFTIDVRDLAEDAN
2a9cA           -------------------------------------------SSYRLRVDGPGGGTLSLSLAELRSRFP
2biiA           -------------------------------------------LDWEVSIEGMVETPYKIKLSDIMEQFD
2a9dB           -------------------------------------------SSYRLRVDGPGGRTLSLSLAELRSRFP
2a9aB           -----------------------------------------------LRVDGPGGGTLSLSLAELRSRFP
2a9dA           ----------------------------------------------------------------------
2ca3A           --FSVFDEGLITPND-AFFVMYH----------LAGIPLEIDPDAFRLEIKGKVGTPLSLSLQDLKNDFP
2bihA           -------------------------------------------------IEGMVETPYKIKLSDIMEQFD
2a9aA           ----------LTPNE-LFFTRNHLPVPAVEPSSYRLR------------VDGPGGGTLSLSLAELRSRFP
2a99A           ----------LTPNE-LFFTRNHLPVPAVEPSSYRLR------------VDGPGGGTLSLSLAELRSRFP


                         +         .         .         .         .         *         .:210
query           QETMMACSCATGSPFGQAAVMGVPLSAVVEMADLEDGVNTITAYGADGFGQPLPLRYALEKNALLAYQVN
2a9cA           KHEVTALQCAGGLPWDIGAISGARLRDVLLHAGFLQGEWHVCFEGLDPYGASIPYGRALAADVLLAYEMN
2biiA           IYSTMVCAGGAGFNWGAAGTSGCMLGDVIGKARPSKRARFVWMEGADAYGTCIRLSWCMDPEIMIAYQQN
2a9dB           KHEVTALQCAGGLPWDIGAISGARLRDVLLHAGFLQGEWHVCFEGLDAYGASIPYGRALSPAVLLAYEMN
2a9aB           KHEVLQCAGNRGLPWDIGAISGARLRDVLLHAGFLQGEWHVCFEGLDPYGASIPYGRALAADVLLAYEMN
2a9dA           -----------GLPWDIGAISGARLRDVLLHAGFLQGEWHVCFEGLDAYGASIPYGRALAADVLLAYEMN
2ca3A           ASEVVAVQCSGNSRGFVEPRVGVPLKAVLEKAGVQAGAKQVTFGGLDGFVKALSIDHATDGEVMLAYSMN
2bihA           IYSTPVMVCAGGFNWGAAGTSGCMLGDVIGKARPSKRARFVWMEGADNTCIRLSWCMDPERCIMIAYQQN
2a9aA           KHEVTATRPVKGLPWDIGAIGGARLRDVLLHAGFLQGEWHVCFEGLDADSIPYGRALSPAADVLLAYEMN
2a99A           KHEVTATRPVKGLPWDIGAIGGARLRDVLLHAGFLQGEWHVCFEGLDADSIPYGRALSPAADVLLAYEMN


                         .         .         .         +         .         .         .:280
query           GQELEAATGSSLQLWMPETVARYFTRDIVNIELTQEDAEPDVQQVDPCYRNKINIMNYSDDCVFKAGDEI
2a9cA           GTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYQELPVQSAVTQPRPGAAVPPGEL
2biiA           GEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSETMVTPEMAKSDDRIYDLNLQQQVIKISEDEY
2a9dB           GTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPPCVDWDTVDYRTAPAIQELPVQSAVTQPGEL
2a9aB           GTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPPPGEL
2a9dA           GTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPQQNDYKGFSPCVDWDTVDAVTQPRPGAAVPPG-EL
2ca3A           GADLPWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAPINRFDVRSFITNVNGASVKAGEV
2bihA           GEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDRVLPTMVTPEMAKSQVIKISEDEY
2a9aA           GTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQEL
2a99A           GTELPRDHGFPVRVVVPGVVARSVKWLRRVAVSPDEQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVT


                         .         *         .         .         .         .         +:350
query           TFEGVADDLGSPIAAIEFSFDNGRTWTSCDTDGATADKWVNWQFTTSFEEKGDYRMTVRAKTADGMVSPL
2a9cA           TVKGYASGGGREVVRVDVSLDGGRTWKVARLMGGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPD
2biiA           EIAGFGNGGGVRIGRIEVSLDKGKSWKLADCDRMSCLCWCFWKLKVPSELARSKDILIRGMDERMMVQPR
2a9dB           TVKGYASGGGREVVRVDVSLDGGRTWKVARLMGGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPD
2a9aB           TVKGYASGGGREVVRVDVSLDGGRTWKVARLMGGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPD
2a9dA           TVKGAWSGGGREVVRVDVSLDGGRTWKVARLMGDRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPD
2ca3A           PLRGIAFDGGYGITQVSVSADAGKSWTNATLDPGLGKYSFRGWKAVLPLTKGDHVLMCRATNARGETQPM
2bihA           EIAGFGNGGGVRIGRIEVSLDKGKSWKLADCDRMSCLCWCFWKLKPLSELARSKDILIRGMDERMMVQPR
2a9aA           PVQSAVTQ-PRPGAAVPWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGR------------------
2a99A           QPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGG---RTWKVARLMGDKAP------------------


                         .         .         .         .         *         .         .:420
query           AATLLFEVA
2a9cA           SVAPIWNLR
2biiA           TMYW-----
2a9dB           SVAPIWNLR
2a9aB           SVAPIWNLR
2a9dA           SVAPIWNLR
2ca3A           QAT------
2bihA           TMY------
2a9aA           ---------
2a99A           ---------