[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55075.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1aipH.bssp"
#ERROR : Can't open dsspfile "1aipC.bssp"
#ERROR : Can't open dsspfile "1efuB.bssp"
#ERROR : Can't open dsspfile "2cp9A.bssp"
#ERROR : Can't open dsspfile "2cwbA.bssp"
#ERROR : Can't open dsspfile "2bweC.bssp"
#ERROR : Can't open dsspfile "2dnaA.bssp"
#ERROR : Can't open dsspfile "2cp8A.bssp"
#ERROR : Can't open dsspfile "2bwbD.bssp"
#ERROR : Can't open dsspfile "2bweD.bssp"
#ERROR : Can't open dsspfile "2bwbB.bssp"
#ERROR : Can't open dsspfile "2dahA.bssp"
#ERROR : Can't open dsspfile "2bweK.bssp"
#ERROR : Can't open dsspfile "2bwbA.bssp"
#ERROR : Can't open dsspfile "2dakA.bssp"
#ERROR : Can't open dsspfile "2bweB.bssp"
#ERROR : Can't open dsspfile "2dalA.bssp"
#ERROR : Can't open dsspfile "2dklA.bssp"
#ERROR : Can't open dsspfile "2damA.bssp"
#ERROR : Can't open dsspfile "2do6A.bssp"
#ERROR : Can't open dsspfile "3e21A.bssp"
#ERROR : Can't open dsspfile "2bwbI.bssp"
#ERROR : Can't open dsspfile "2daiA.bssp"
#ERROR : Can't open dsspfile "2dhyA.bssp"
#ERROR : Can't open dsspfile "2di0A.bssp"

## Summary of PDB Search
:286
    8e-41  31%  1aipH  [a.5.2 - d.43.1] ELONGATION FACTOR TS
    4e-40  31%  1aipC  [a.5.2 - d.43.1] ELONGATION FACTOR TS
    2e-36  33%  1efuB  [a.5.2 - d.43.1 - d.43.1] ELONGATION FACTOR TS
    9e-18  30%  2cp9A  [x.x.x] ELONGATION FACTOR TS, MITOCHONDRIAL
    9e-11  20%  2cwbA  [x.x.x] CHIMERA OF IMMUNOGLOBULIN G BINDING PROTEIN G
    1e-10  19%  2bweC  [x.x.x] DSK2
    1e-10  18%  2dnaA  [x.x.x] UNNAMED PROTEIN PRODUCT
    2e-10  23%  2cp8A  [x.x.x] NEXT TO BRCA1 GENE 1 PROTEIN
    2e-10  20%  2bwbD  [x.x.x] UBIQUITIN-LIKE PROTEIN DSK2
    4e-10  20%  2bweD  [x.x.x] DSK2
    6e-10  21%  2bwbB  [x.x.x] UBIQUITIN-LIKE PROTEIN DSK2
    9e-10  24%  2dahA  [x.x.x] UBIQUILIN-3
    1e-09  20%  2bweK  [x.x.x] DSK2
    1e-09  21%  2bwbA  [x.x.x] UBIQUITIN-LIKE PROTEIN DSK2
    2e-09  21%  2dakA  [x.x.x] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 5
    8e-09  21%  2bweB  [x.x.x] DSK2
    3e-08  22%  2dalA  [x.x.x] PROTEIN KIAA0794
    3e-08  21%  2dklA  [x.x.x] TRINUCLEOTIDE REPEAT CONTAINING 6C PROTEIN
    4e-07  21%  2damA  [x.x.x] ETEA PROTEIN
    5e-07  23%  2do6A  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE CBL-B
    6e-07  12%  3e21A  [x.x.x] FAS-ASSOCIATED FACTOR 1
    1e-06  22%  2bwbI  [x.x.x] UBIQUITIN-LIKE PROTEIN DSK2
    1e-06  27%  2daiA  [x.x.x] UBIQUITIN ASSOCIATED DOMAIN CONTAINING 1
    6e-05  17%  2dhyA  [x.x.x] CUE DOMAIN-CONTAINING PROTEIN 1
    8e-05  12%  2di0A  [x.x.x] ACTIVATING SIGNAL COINTEGRATOR 1 COMPLEX SUBUNIT
:286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEGTVMAIVSDDA
1aipH           -----MELIKKLREATGAGMMDVKRALEDAGWDEEKAVQLLRERGAMKAAKKADREAREGIIGHYIHHNQ
1aipC           -----MELIKKLREATGAGMMDVKRALEDAGWDEEKAVQLLRERGAMKAAKKADREAREGIIGHYIHHNQ
1efuB           -AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVI--KTKIDG
2cp9A           ------ELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAASGPSSG----------
2cwbA           -GSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGG-------------------------
2bweC           ---RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV------------------------
2dnaA           --VRFSKEMECLQAMGFVNYNANLQALIATDGDTNAAIYKLKSSQGFS-GPSSG----------------
2cp8A           -SGQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLSGPS----------------------
2bwbD           PEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL-----------------------------
2bweD           PEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL-----------------------------
2bwbB           ---RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL-----------------------------
2dahA           -SGHFQVQLEQLRSMGFLNREANLQALIATGGDVDAAVEKLRQSSGP-----------------------
2bweK           ---RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLN---------------------------
2bwbA           --ERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL-----------------------------
2dakA           -SGPPEDCVTTIVSM-GFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMSGPSSG----------
2bweB           --ERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL-----------------------------
2dalA           -------LIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGS-----------------------
2dklA           EAWIMSRLIKQLTDM-GFPREPAEEALKSNNMNLDQAMSALLEKKVDVDKRGLGVTDHNGMAAKSGP---
2damA           LTQEQTEKLLQFQDLTGIESMDCRHTLEQHNWNIEAAVQDRL----------------------------
2do6A           --GNVDAKIAKLMGE-GYAFEEVKRALEIAQNNVEVARSILREFSGPSSG--------------------
3e21A           -------ILADFQACTGIENIDAITLLEQNNWDLVAAINGV-----------------------------
2bwbI           ---PEERYEHQLRQL-NFDFDRNVAALRRSGGSVQGALDSL-----------------------------
2daiA           ---VDEAALRQLTEM-GFPENRATKALQLNHMSVPQAMEWLIEHA-------------------------
2dhyA           ------QAMDDFKTMFNMDYDIIECVLRANSGAVDATIDQL-----------------------------
2di0A           CGVELDSLISQVKDLLPDGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRN--------------


                         .         .         *         .         .         .         .:140
query           TSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKPXXXXXXXXXXXXGETVEAVVTDAIHTLGENIQL
1aipH           RVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPEIPAEELEKERQIYIQAALNEGKPQQIAEKIAE
1aipC           RVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPEIPAEELEKERQIYIQAALNEGKPQQIAEKIAE
1efuB           NYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKIVEVLKAQFEEERVALVAKIGENINIRRVAALEG
2cp9A           ----------------------------------------------------------------------
2cwbA           ----------------------------------------------------------------------
2bweC           ----------------------------------------------------------------------
2dnaA           ----------------------------------------------------------------------
2cp8A           ----------------------------------------------------------------------
2bwbD           ----------------------------------------------------------------------
2bweD           ----------------------------------------------------------------------
2bwbB           ----------------------------------------------------------------------
2dahA           ----------------------------------------------------------------------
2bweK           ----------------------------------------------------------------------
2bwbA           ----------------------------------------------------------------------
2dakA           ----------------------------------------------------------------------
2bweB           ----------------------------------------------------------------------
2dalA           ----------------------------------------------------------------------
2dklA           ----------------------------------------------------------------------
2damA           ----------------------------------------------------------------------
2do6A           ----------------------------------------------------------------------
3e21A           ----------------------------------------------------------------------
2bwbI           ----------------------------------------------------------------------
2daiA           ----------------------------------------------------------------------
2dhyA           ----------------------------------------------------------------------
2di0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARFAVVEGGAVSSYIHGGGKIGVLVQFDVEGIDPASDGFKQFGRDXXXXXXXXXXXXXTRESVDPAIVEH
1aipH           GRLKKYLEEVVQPFVK-DDKVKVKEL--------------------------------------------
1aipC           GRLKKYLEEVVQPFVK-DDKVKVKEL--------------------------------------------
1efuB           DVLGSYQHGARIGVLVAAKGAD-----------------EELVKHIAMHVAASKPEFIKPEDVSAEVVEK
2cp9A           ----------------------------------------------------------------------
2cwbA           ----------------------------------------------------------------------
2bweC           ----------------------------------------------------------------------
2dnaA           ----------------------------------------------------------------------
2cp8A           ----------------------------------------------------------------------
2bwbD           ----------------------------------------------------------------------
2bweD           ----------------------------------------------------------------------
2bwbB           ----------------------------------------------------------------------
2dahA           ----------------------------------------------------------------------
2bweK           ----------------------------------------------------------------------
2bwbA           ----------------------------------------------------------------------
2dakA           ----------------------------------------------------------------------
2bweB           ----------------------------------------------------------------------
2dalA           ----------------------------------------------------------------------
2dklA           ----------------------------------------------------------------------
2damA           ----------------------------------------------------------------------
2do6A           ----------------------------------------------------------------------
3e21A           ----------------------------------------------------------------------
2bwbI           ----------------------------------------------------------------------
2daiA           ----------------------------------------------------------------------
2dhyA           ----------------------------------------------------------------------
2di0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EKAIYMAQAAESGKPEAIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAAEVAKNLGGEIKIVDFK
1aipH           ----------------------------------------------------------------------
1aipC           ----------------------------------------------------------------------
1efuB           EYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEH------NAEVTGFI
2cp9A           ----------------------------------------------------------------------
2cwbA           ----------------------------------------------------------------------
2bweC           ----------------------------------------------------------------------
2dnaA           ----------------------------------------------------------------------
2cp8A           ----------------------------------------------------------------------
2bwbD           ----------------------------------------------------------------------
2bweD           ----------------------------------------------------------------------
2bwbB           ----------------------------------------------------------------------
2dahA           ----------------------------------------------------------------------
2bweK           ----------------------------------------------------------------------
2bwbA           ----------------------------------------------------------------------
2dakA           ----------------------------------------------------------------------
2bweB           ----------------------------------------------------------------------
2dalA           ----------------------------------------------------------------------
2dklA           ----------------------------------------------------------------------
2damA           ----------------------------------------------------------------------
2do6A           ----------------------------------------------------------------------
3e21A           ----------------------------------------------------------------------
2bwbI           ----------------------------------------------------------------------
2daiA           ----------------------------------------------------------------------
2dhyA           ----------------------------------------------------------------------
2di0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RFVLGE
1aipH           ------
1aipC           ------
1efuB           RFEVGE
2cp9A           ------
2cwbA           ------
2bweC           ------
2dnaA           ------
2cp8A           ------
2bwbD           ------
2bweD           ------
2bwbB           ------
2dahA           ------
2bweK           ------
2bwbA           ------
2dakA           ------
2bweB           ------
2dalA           ------
2dklA           ------
2damA           ------
2do6A           ------
3e21A           ------
2bwbI           ------
2daiA           ------
2dhyA           ------
2di0A           ------