[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55195.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cllB.bssp"
#ERROR : Can't open dsspfile "1a5sB.bssp"
#ERROR : Can't open dsspfile "2clmB.bssp"
#ERROR : Can't open dsspfile "2cleB.bssp"
#ERROR : Can't open dsspfile "2dh5A.bssp"
#ERROR : Can't open dsspfile "1a5aB.bssp"
#ERROR : Can't open dsspfile "1bksB.bssp"
#ERROR : Can't open dsspfile "2cloB.bssp"
#ERROR : Can't open dsspfile "2dh6A.bssp"
#ERROR : Can't open dsspfile "2d1fA.bssp"
#ERROR : Can't open dsspfile "2c2bA.bssp"
#ERROR : Can't open dsspfile "2c2bC.bssp"
#ERROR : Can't open dsspfile "1e5xA.bssp"
#ERROR : Can't open dsspfile "2c2bE.bssp"
#ERROR : Can't open dsspfile "3bm5B.bssp"
#ERROR : Can't open dsspfile "2c2gB.bssp"
#ERROR : Can't open dsspfile "2c2bB.bssp"
#ERROR : Can't open dsspfile "1e5xB.bssp"
#ERROR : Can't open dsspfile "2c2gA.bssp"
#ERROR : Can't open dsspfile "1d6sA.bssp"
#ERROR : Can't open dsspfile "2bhtC.bssp"
#ERROR : Can't open dsspfile "2bhsB.bssp"
#ERROR : Can't open dsspfile "3dnfB.bssp"
#ERROR : Can't open dsspfile "2bhsA.bssp"
#ERROR : Can't open dsspfile "1ayxA.bssp"
#ERROR : Can't open dsspfile "3dwgA.bssp"
#ERROR : Can't open dsspfile "2bhtA.bssp"
#ERROR : Can't open dsspfile "2bhtB.bssp"
#ERROR : Can't open dsspfile "3dkiA.bssp"
#ERROR : Can't open dsspfile "3dwiB.bssp"
#ERROR : Can't open dsspfile "3dwgB.bssp"
#ERROR : Can't open dsspfile "2bhtD.bssp"
#ERROR : Can't open dsspfile "3dkiB.bssp"
#ERROR : Can't open dsspfile "3dwiA.bssp"
#ERROR : Can't open dsspfile "2eguA.bssp"
#ERROR : Can't open dsspfile "2di4A.bssp"

## Summary of PDB Search
:461
    1e-45  26%  2cllB  [c.79.1 (1k7eB)] TRYPTOPHAN SYNTHASE BETA CHAIN
    1e-44  26%  1a5sB  [c.79.1] TRYPTOPHAN SYNTHASE (BETA CHAIN)
    2e-44  26%  2clmB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    2e-44  25%  2cleB  [x.x.x] TRYPTOPHAN SYNTHASE BETA CHAIN
    7e-44  25%  2dh5A  [x.x.x] TRYPTOPHAN SYNTHASE BETA SUBUNIT
    7e-44  26%  1a5aB  [c.79.1] TRYPTOPHAN SYNTHASE (BETA CHAIN)
    2e-43  26%  1bksB  [c.79.1] TRYPTOPHAN SYNTHASE
    2e-42  25%  2cloB  [c.79.1 (1a50B)] TRYPTOPHAN SYNTHASE BETA CHAIN
    2e-35  27%  2dh6A  [x.x.x] TRYPTOPHAN SYNTHASE BETA SUBUNIT
    2e-34  18%  2d1fA  [x.x.x] THREONINE SYNTHASE
    3e-32  14%  2c2bA  [x.x.x] THREONINE SYNTHASE
    4e-32  14%  2c2bC  [x.x.x] THREONINE SYNTHASE
    1e-31  13%  1e5xA  [c.79.1] THREONINE SYNTHASE
    2e-30  15%  2c2bE  [x.x.x] THREONINE SYNTHASE
    2e-28  20%  3bm5B  [x.x.x] CYSTEINE SYNTHASE
    5e-28  14%  2c2gB  [x.x.x] THREONINE SYNTHASE
    3e-27  14%  2c2bB  [x.x.x] THREONINE SYNTHASE
    4e-27  12%  1e5xB  [c.79.1] THREONINE SYNTHASE
    2e-25  14%  2c2gA  [x.x.x] THREONINE SYNTHASE
    4e-25  20%  1d6sA  [c.79.1] O-ACETYLSERINE SULFHYDRYLASE
    6e-25  19%  2bhtC  [x.x.x] CYSTEINE SYNTHASE B
    7e-25  18%  2bhsB  [x.x.x] CYSTEINE SYNTHASE B
    5e-23  10%  3dnfB  [x.x.x] 4-HYDROXY-3-METHYLBUT-2-ENYL DIPHOSPHATE
    9e-23  18%  2bhsA  [x.x.x] CYSTEINE SYNTHASE B
    1e-21   6%  1ayxA  [x.x.x] GLUCOAMYLASE
    1e-20  19%  3dwgA  [x.x.x] CYSTEINE SYNTHASE B
    7e-20  18%  2bhtA  [x.x.x] CYSTEINE SYNTHASE B
    1e-19  18%  2bhtB  [x.x.x] CYSTEINE SYNTHASE B
    6e-19  17%  3dkiA  [x.x.x] CYSTEINE SYNTHASE B
    4e-18  20%  3dwiB  [x.x.x] CYSTEINE SYNTHASE B
    1e-17  18%  3dwgB  [x.x.x] CYSTEINE SYNTHASE B
    6e-13  18%  2bhtD  [x.x.x] CYSTEINE SYNTHASE B
    7e-13  20%  3dkiB  [x.x.x] CYSTEINE SYNTHASE B
    1e-10  16%  3dwiA  [x.x.x] CYSTEINE SYNTHASE B
    1e-06  24%  2eguA  [x.x.x] CYSTEINE SYNTHASE
    8e-04  11%  2di4A  [x.x.x] CELL DIVISION PROTEIN FTSH HOMOLOG
:461

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQELDDDTAYVDIP
2cllB           ------------------------------------EFGGMYVPQILMPAL-NQLEEAFVSKDPEFQAQF
1a5sB           ------------------------------------EFGGMYVPQILMPAL-NQLEEAFVRAQKDPEFQA
2clmB           ------------------------------------EFGGMYVPQILMPAL-NQLEEAFVRAQKDPEFQA
2cleB           ------------------------------------EFGGMYVPQILMPAL-NQLEEAFVRAQKDPEFQA
2dh5A           ------------------------------------EFGGMYVPQILMPAL-RQLEEAFVSAQ-KDPEFQ
1a5aB           ------------------------------------EFGGMYVPQILMPAL-NQLEEAFVRKDPEFQAQF
1bksB           ------------------------------------EFGGMYVPQILMPAL-NQLEEAFVRAQKDPEFQA
2cloB           ------------------------------------EFGGMYVPQILMPAL-NQLEEAFVRAQKDPEFQA
2dh6A           -------------------------------------------PQILMPAL-RQLEEAFVSKDPEFQAQF
2d1fA           -----------------------------------------------------------------RLPVG
2c2bA           -----------------------------------------------------PYGSGVWSKKEWVLPEI
2c2bC           -----------------------------------------------------------------VLPEI
1e5xA           ----------------STESYSLDEIVYRGLLDVEHDEALKRFDGAYWRDLFDSRVGKSTWPYGSKKEWV
2c2bE           -----------------------------------------AYWRDLFDSRVGKSTWPYGSGVWSKKEWV
3bm5B           ----------------------------------------------------------------------
2c2gB           -----------------------------------------------------------------VLPEI
2c2bB           -----------------------------------------------------------------VLPEI
1e5xB           --------------PGSTESYSLDEIVGLLDVEHDEALKRFDGADLFDSRVGKSTWPYGSGVWSKKEWEI
2c2gA           -----------------------------------------------------------------VLPEI
1d6sA           ----------------------------------------------------------------------
2bhtC           ----------------------------------------------------------------------
2bhsB           ----------------------------------------------------------------------
3dnfB           ----------------------------------------------------------------------
2bhsA           ----------------------------------------------------------------------
1ayxA           ----------------------------------------------------------------------
3dwgA           ----------------------------------------------------------------------
2bhtA           ----------------------------------------------------------------------
2bhtB           ----------------------------------------------------------------------
3dkiA           ----------------------------------------------------------------------
3dwiB           ----------------------------------------------------------------------
3dwgB           ----------------------------------------------------------------------
2bhtD           ----------------------------------------------------------------------
3dkiB           ----------------------------------------------------------------------
3dwiA           ----------------------------------------------------------------------
2eguA           ----------------------------------------------------------------------
2di4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAIAQAYYAKAQDLDGITTETGA
2cllB           ADLLKNY-AGRPTALTKCQNITAGTR--TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1a5sB           QFADLLNYAGRPTALTKCQNITAGTR--TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2clmB           QFADLLNYAGRPTALTKCQNITAGTR--TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2cleB           QFADLLNYAGRPTALTKCQNITA--GTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2dh5A           AQFNDLLKAGRPTALTKCQNITA--GTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
1a5aB           ADLLKNY-AGRPTALTKCQNITAGTR--TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
1bksB           QFADLLNYAGRPTALTKCQNITA--GTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2cloB           QFADLLNYAGRPTALTKCQNITAGTR--TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGA
2dh6A           NDLLKNY-AGRPTALTKCQNITAGTN--TTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGA
2d1fA           DDWTPVTLLEGGTPLIAATNLSK--QTGCTIHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTG
2c2bA           DDDDIVSAFEGNSNLFWAERFGKQFLGMNDLWVKHCGISHTGSFDLGMTVLVSQVNRKMKRPVVGVCAST
2c2bC           DDDDIVSAFEGNSNLFWAERFGKQFLGMNDLWVKHCGISHTGSFDLGMTVLVSQVNRKMKRPVVGVCAST
1e5xA           LPEIDVSAFEGNSNLFWAERFGKQFL-GNDLWVKHCGISHTGSFKDLGTVLVSQVNRLRKKRPVVGCAST
2c2bE           LPEIDDDDIEGNSNLFWAERFGKQFLGMNDLWVKHCGISHTGSFDLGMTVLVSQVNRLRKMVVGVGCAST
3bm5B           ----NILETIGGTPLVELHGVTEHPRKGTRILVKLEYFNPMSSVKDRVGVYQAIKDGRLKPGMEIIESTS
2c2gB           DDDDIVSAFEGNSNLFWAERFGKQFLGMNDLWVKHCGISHTGSFDLGMTVLVSQVNRKMKRPVVGVCAST
2c2bB           DDDDIVSAFEGNSNLFWAERFGKQFLGMNDLWVKHCGISHTGSFDLGMTVLVSQVNRLRKMVVGVGCAST
1e5xB           DDDDIVSAFEGNSNLFWAERFGKQFL-GNDLWVKHCGISHTGSFKDLGTVLVSQVNRLRKKRPVVGCAST
2c2gA           DDDDIVSAFEGNSNLFWAERFGKQFLGMNDLWVKHCGISHTGSFDLGMTVLVSQVNRLRKMKVGVGCAST
1d6sA           ------SLTIGHTPLVRLNRI-----GNGRILAKVESRNPSFSVACRIGANMIWDAEKRGVGVELVEPTN
2bhtC           -----LEQTIGNTPLVKLQRMGPDNG--SEVWLKLEGNNPAGSVDRASMIVEAEKRGRIKPGDVLIEATS
2bhsB           ----------GNTPLVKLQRMGPDNG--SEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIDVLIEATS
3dnfB           ------FCFGVKRAVKLAEESLKESQ--GKVYTLGPIIHNPQEVNRL--KNLGVFPSQGEEFKEGDTVII
2bhsA           ------EQTIGNTPLVKLQRMGPDNG--SEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIDVLIEATS
1ayxA           --------NNGVPGTVIASPSTSNPDWTRDSAITFLTVLSELEDNNFNTTLAKAVEYYINTSYN------
3dwgA           ------LQALGNTPLVGLQRLSPRWDDHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADGLLRPGAEPTS
2bhtA           -----MSTLEGNTPLVKLQRMGPDNG--SEVWLKLEGNNPAGSVDRAALIVEAEKRGRIKPGDVLIEATS
2bhtB           -----MSTLEGNTPLVKLQRMGPDNG--SEVWLKLEGNNPAGSVDRASMIVEAEKRGRIKPGDVLIEATS
3dkiA           ------LQALGNTPLVGLQRLDGRDGPHVRLWAKLEDRNPTGSIDRPRMIEQAEADGLLRPGATILEPTS
3dwiB           ----------GNTPLVGLQRLSPRWDDHVRLWAKLEDRNPTGSIKDRPAVRMIEQADGLLRPGATLEPTS
3dwgB           ------LQALGNTPLVGLQRLSPRWDDHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADRPGATILEPTS
2bhtD           -------TLEGNTPLVKLQRMGPDNG--SEVWLKLEGNNPAGSVDRASMIVEAEKRGRIKPGDVLIEATS
3dkiB           ------LQALGNTPLVGLQRLDGRDGPHVRLWAKLEDRNPTGSIDRPRMIEQAEADGLLRPGATILEPTS
3dwiA           ----SLLQALGNTPLVGLQRLDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQGLLRPGATIL-EPTS
2eguA           ---------------------RIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEKAGKLKTIVEPTS
2di4A           ---------------------------------------------------------------KIAIHEA


                         +         .         .         .         .         *         .:210
query           GQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETFDAHVTPSPSDTTEIGRKMLAEHPDSSGSLG
2cllB           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS---------------GSATLK
1a5sB           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS---------------GSATLK
2clmB           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS---------------GSATLK
2cleB           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS---------------GSATLK
2dh5A           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIP---------------VHSGSATLK
1a5aB           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS---------------GSATLK
1bksB           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS---------------GSATLK
2cloB           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS---------------GSATLK
2dh6A           GQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSG---------------SATLK
2d1fA           NTSASAAAYA-ARAGITCAVLIPQGKIA--MGKLAQAVMHGAKIIQID------------------GNFD
2c2bA           GDTSAALSAYCASAGIPSIVFLPANKIS--MAQLVQPIANGAFVLSIDTD--------------------
2c2bC           GDTSAALSAYCASAGIPSIVFLPANKIS--MAQLVQPIANGAFVLSI----------------------D
1e5xA           GDTSAALSAYCASAGIPSIVFLPANKISAQLVQ---PIANGAFVLSIDTD--------------------
2c2bE           GDTSAALSAYCASAGIPSIVFLPANKISMA--QLVQPIANGAFVLS----------------------ID
3bm5B           GNTGIALCQAGAVFGYRVNIAMPSTMSVER---QMIMKAFGAELILTEGK----------------KGMP
2c2gB           GDTSAALSAYCASAGIPSIVFLPANKISMA--QLVQPIANGAFVLSIDTD--------------------
2c2bB           GDTSAALSAYCASAGIPSIVFLPANKISMA--QLVQPIANGAFVLSIDTD--------------------
1e5xB           GDTSAALSAYCASAGIPSIVFLPA---NKISAQLVQPIANGAFVLSIDTD--------------------
2c2gA           GDTSAALSAYCASAGIPSIVFLPANKISM--AQLVQPIANGAFVLSIDTD--------------------
1d6sA           GNTGIALAYVAAARGYKLTLTMPETMSIERR---KLLKALGANLVLTEGAKGMKG---------------
2bhtC           GNTGIALAMIAALKGYRMKLL---MPDNMSQERRAAMRAYGAELILVTKEQGMEG---------------
2bhsB           GNTGIALAMIAALKGYRMKLL---MPDNMSQERRAAMRAYGAELILVTKE----------------QGME
3dnfB           RSHGIPPEKEEALRKKGLKVIDATCPYVKAVEAVCQLTREGYFVVLVGEKNHPEVIGTLGYLRACNG--K
2bhsA           GNTGIALAMIAALKGYRMKLLMPD---NMSQERRAAMRAYGAELILVTKEQG----------------ME
1ayxA           ---------LQRTSNPSGSFDDENHKGLGEPKGSAYTGAWGRPQNDGPALRAYAISRYLNDVNSLNEGKL
3dwgA           GNTGISLAMAARLKGYR--LICV-MPENTSVERRQLLELYGAQIIFSAAEGGSNT---------------
2bhtA           GNTGIALAMIAALKGYR---MKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEG---------------
2bhtB           GNTGIALAMIAALKGYRMKLLMPDN-------RRAAMRAYGAEL--------------------------
3dkiA           GNTGISLAMAARLKGYRLICVMPENTSVER-RQLLELYGAQIIFSAAEGGSNT-----------------
3dwiB           GNTGISLAMAARLKGYRLICVM---PENTSVERRQLLELYGAQIIFSAASNTA-----------------
3dwgB           GNTGISLAMAARLKGYRLICV---MPENTSVERRQLLELYGAQIIFSAANTAVATAKELAATNP------
2bhtD           GNTGIALAMIAALKGYRMKLLMP-------DERRAAMRAYGAELIMEGARDLALEMANRGEGKL------
3dkiB           GNTGISLAMAARLKGYRLICV---MPENTSVERRQLLELYGAQIIFS----------------------A
3dwiA           GNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAGGSNTAVATAKELAATNP-------
2eguA           GNTGIGLAMVAAAKGYKAVLV---MPDTMSLERRNLLRAYGAELVLTPGAQGM-----------------
2di4A           GHALMGLVSDDDDKVHKISIIKHIYDKKDLYGRAAEEVFFGKDGITTGARATDLAYRMVSMWGMS-----


                         .         .         .         +         .         .         .:280
query           TAISEAVERALNIPGNKGRYTLGSVLNQVVLHQSVIGLESYAAFEELGEYPDVVIXXXXXXXXXXXLIAP
2cllB           DACNEALRDWSGSY-ETAHYMLGTAAGIVREFQRMIGEETKAQIDKEGRLPDAVIACVGGGSNAIGMFAD
1a5sB           DACNEALRDWSGS-YETAHYMLGTAAGPVREFQRMIGEETKAQIDKEGRLPDAVIACVGGGSNAIGMFAD
2clmB           DACNEA-LRDWSGSYETAHYMLGTAAGPVREFQRMIGEETKAQIDKEGRLPDAVIACVGGGSNAIGMFAD
2cleB           DACNEALRDWSGSY-ETAHYMLGTAAGPVREFQRMIGEETKAQIDKEGRLPDAVIACVGGGSNAIGMFAD
2dh5A           DACNEALRDWSGSY-ETAHYMLGTAAGPVREFQRMIGEETKAQIEREGRLPDAVIACVGGGSNAIGMFAD
1a5aB           DACNEALRDWSGS-YETAHYMLGTAAGPVREFQRMIGEETKAQIDKEGRLPDAVIACVGGGSNAIGMFAD
1bksB           DACNEALRDWSGS-YETAHYMLGTAAGPVREFQRMIGEETKAQIDKEGRLPDAVIACVGGGSNAIGMFAD
2cloB           DACNEALRDWSGS-YETAHYMLGTAAGPVREFQRMIGEETKAQIDKEGRLPDAVIACVGGGSNAIGMFAD
2dh6A           DACNEALRDWSGSYETAH-YMLGTAAGPVREFQRMIGEETKAQILERE----------------------
2d1fA           DCL-ELARKMAADFPTI--SLVNSVNPVRIEGQKTAAFEIV---DVLGTAPDVHALPVGNAGNITAYWKG
2c2bA           --FDGCMKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFD--WQVPDWVIVPGGNLGNIYAFYKG
2c2bC           TDFDGCMKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFD--WQVPDWVIVPGGNLGNIYAFYKG
1e5xA           ---FDGCKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFD--WQVPDWVIVPGGNLGNIYA-FYK
2c2bE           TDFDGCMKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFD--WQVPDWVIVPGGNLGNIYAFYKG
3bm5B           GAIEEVNKMIKENPGKY-FVANQFGNPDNTAAHHYTANE---IWEDTDGEVDIVVSAVGTSGTVIG-VAE
2c2gB           --FDGCMKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFD--WQVPDWVIVPGGNLGNIYAFYKG
2c2bB           --FDGCMKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFD--WQVPDWVIVPGGNLGNIYAFYKG
1e5xB           ---FDGCKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFD--WQVPDWVIVPGGNLGNIYAFYKG
2c2gA           --FDGCMKLIREITAELPIYLANSLNSLRLEGQKTAAIEILQQFDW--QVPDWVIVPGGNLGNIYAFYKG
1d6sA           -AIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPE---IWEDTDGQVDVFISGVGTGGTLTGVTRY
2bhtC           -ARDLALEMANRGEGK--LLDQFNNPDNPKAHYTTTGPE---IWQQTGGRITHFVSSMGTTGTITGVSEF
2bhsB           GARDLALEMANRGEGKLLDQFNNP--DNPYAHYTTTGPE---IWQQTGGRITHFVSSMGTTGTITGVSRF
3dnfB           GIVVETLEDIGEALKHE---------RVGIVAQTTQNEE---FFKEVVGEIALWVKEVKVINTICNATSL
2bhsA           GARDLALEMANRGEGKLLDQ--FNNPDNPYAHYTTTGPE---IWQQTGGRITHFVSSMGTTGTITGVSRF
1ayxA           VLTDSGDI-----NFSSTEDIYKNIIKPDLEYVIGYWDSTGFDLWEEGRHFFTSLVQQKALAYAVDIAKS
3dwgA           -AVATAKELAATNPS--WVMLYQYGNPANTDHYCGTGPE---LLADLPEITHFVAGLGTTGTLMGTGRFL
2bhtA           -ARDLALEMANR--GEGKLLDQFNNPDNPKAHYTTTG---PEIWQQTGGRITHFVSSMGTTGTITGVSEF
2bhtB           ----IEGARDEMANRGEGKLLDQFNNPDPKAHYTTTGPEI---WQQTGGRITHFVSSMGTTGTITGVSEF
3dkiA           -AVATAKELAATNPS--WVMLYQYGNPANTDHYCGTGPE---LLADLPEITHFVAGLGTTGTLMGTGRFL
3dwiB           --VATAKELAATNPSWVMLYQYG-NPANTDSHYCGTGPE---LLADLPEITHFVAGLGTTGTLMGTGRFL
3dwgB           ---------------SWVMLYQYGNPANTDSHYCGTGPE---LLADLPEITHFVAGLGTTGTLMGTGRFL
2bhtD           -------------------LDQFNNPDNPKAHYTTTGPE---IWQQTGGRITHFVSSMGTTGTITGVSEF
3dkiB           TAVATAKELAATNPSWVMLYQYGNPAN-TDSHYCGTGPELLADLPE----ITHFVAGLGTTGTLMGTGRF
3dwiA           ------SWVMLYQYGNP---------ANTDSHYCGTGPELLADL----PEITHFVAGLGTTGTLMGTGRF
2eguA           ---RGAIAKAEELVREHGYF---------------MPTTGKEIVEQMGDQLDAFVAGVGTGGTITG----
2di4A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FMRDKIKGVRPDTRFVAVEPASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMS
2cllB           FIND------TSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMDGQIEESYSISAGLDFPSVG
1a5sB           FIND------TSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMDGQIEESYSISAGLDFPSVG
2clmB           FIND------TSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMDGQIEESYSISAGLDFPSVG
2cleB           FI------NDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMDGQIEESYSISAGLDFPSVG
2dh5A           FI------NETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEQIEESYSSAGLDFPSVG
1a5aB           FIND------TSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMDGQIEESYSISAGLDFPSVG
1bksB           FIND------TSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMDGQIEESYSISAGLDFPSVG
2cloB           FI------NDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMDGQIEESYSISAGLDFPSVG
2dh6A           ----------GRLPDAVIACVGGGSNAIGMFA--------------------DFINETNVGLIGVEPGVG
2d1fA           YTEYHLGLIDKLPRMLGTQAAGAAPLVLGEPV--------------------SHPETIATAIRIGSPASW
2c2bA           FKMCQLGLVDRIPRMVCAQAANANPLYLHYKSGWKDFKPMT--------------ASTTFASAIQIGDPV
2c2bC           FMCQELGLVDRIPRMVCAQAANANPLYLHYKSGWKDFKPMT--------------ASTTFASAIQIGDPV
1e5xA           GFKCQELGLVDRIPRVCAQAANANPLYLH-----------------------------YKSGWKDFKPVS
2c2bE           FMCQELGLVDRIPRMVCAQAANANPLYLHYKSG-----------------WKDVSIDRAVYALKKCNGIV
3bm5B           KLKEKKKGIK----IIAVEPEESAVLEGKAKGPH----------------------------GIQGIGAG
2c2gB           FKMCQ-----ELGLVDRIPR------------MVCAQAANANPLYLHYKSGWKDFKPVSIDRAVYA----
2c2bB           FKMCQLGLVDRIPRMVCAQAANANPLYLHYKSG-----------------WKDVSIDRAVYALKKCNGIV
1e5xB           F-KCQELGLVDRIPRVCAQAANANPLYLHYKSG--------------------------------WKDFK
2c2gA           FKMCQLGLVDRIPRMVCAQAANANPLYLH------------------------------YKSGWKDFKPV
1d6sA           IKGTKGK---TDLITVAVEPTDSPVIAQALAGEEIKP----------------------GPHKIQGIGAG
2bhtC           MRE-----QSKPVTIVGLQPEEGSS-----------------------------------IPGIRRWPTE
2bhsB           M-----REQSKPVTIVGLQPEEGSSIPG-----------------------------------IRRWPTE
3dnfB           RQESVKKLA-PEVDVMIIIGGKNSGN------------------------------TRRLYYISKELNP-
2bhsA           M-----REQSKPVTIVGLQPEEGS-----------------------------------SIPGIRRWPTE
1ayxA           FDDGDFAN-----TLSSTASTLESYLSGSDGGFVN-------TDVNHIVENPDLLQQNSRQG-LDSATYI
3dwgA           REHV------ANVKIVAAEPRYGEGVY-----------------------------------ALRNMDEG
2bhtA           M-----REQSKPVTIVGLQPEEGS-----------------------------------SIPGIRRWPTE
2bhtB           M-----REQSKPVTIVGLQPEEGS-----------------------------------SIPGIRRWPTE
3dkiA           REHV------ANVKIVAAEPRYGEGVYA-----------------------------------LRNMDEG
3dwiB           REHV------ANVAIVAAEPRYGEGVYALRNMDEGFVPELYD---------------PEILT--------
3dwgB           REHV------ANVKIVAAEPRYGEGVYALRNMD-----------------------------------EG
2bhtD           M-----REQSKPVTIVGLQPEEGSSIPGI-----------------------------------RRWPTE
3dkiB           L-----REHVANVKIVAAEPVPELYDPEILTA--------------------------------------
3dwiA           LREH-----VANVAIVAAEPRVPELYDPEILTARYSVG--------------------------------
2eguA           -AGKVLREAYPNIKIYAVEPADDILDTSI------------------------------YDGVIT-----
2di4A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PIVSKLKHDGYLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG
2cllB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMRE--QPEKEQLLVVNLSG
1a5sB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMRE--QPEKEQLLVVNLSG
2clmB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMRE--QPEKEQLLVVNLSG
2cleB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMRE--QPEKEQLLVVNLSG
2dh5A           PQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRE--NPDKEQLLVVNLSG
1a5aB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMRE--QPEKEQLLVVNLSG
1bksB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMRE--QPEKEQLLVVNLSG
2cloB           PQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMRE--QPEKEQLLVVNLSG
2dh6A           PQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRENP--DKEQLLVVNLSG
2d1fA           TSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDD-GWVARGSTVVCTVTG
2c2bA           SIDRAVYLKKCNGIVEEATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNQ-GVIAPTDRTVVVSTA
2c2bC           SIDRAVYALKKCNGIVEEATEELMDAMAQADSTGMFICPHTGVALTALFKLRNQ-GVIAPTDRTVVVSTA
1e5xA           IDRAVYALKKC---NGIVEEATEEELDAAQADSTGFICPHTGVALTALFKLRNQ-GVIAPTDRTVVVSTA
2c2bE           EEAT---------------EEELMDAMAQADSTGMFICPHTGVALTALFKLRNQ-GVIAPTDRTVVVSTA
3bm5B           FIPDIYKKEFVDEIIPIKTQDAWKMARAVVKYDGIMCGMSSGAAILAGLKEAEK--PENEGKTIVIIVPS
2c2gB           -------LKKCNGIVEEATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNQ-GVIAPTDRTVVVSTA
2c2bB           EEATE---------------EELMDAMAQADSTGMFICPHTGVALTALFKLRNQ-GVIAPTDRTVVVSTA
1e5xB           PVSIDRAVYALKKCNGIVEEATEEELDAAQADSTGFICPHTGVALT-ALFKLRNQGVIAPTDRTVVVSTA
2c2gA           SIDRAVYALKKCNGIVEEATEELMDAMAQADSTGMFICPHTGVALT-ALFKLRNQGVIAPTDRTVVVSTA
1d6sA           FIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTN--KNIVVILPS
2bhtC           YLPGIFNASLVDEVLDIHQRDAENTMRELAVREGIFCGVSSG----GAVAGALRVAKANPDAVVVAIICD
2bhsB           YLPGIFNASLVDEVLDIHQRDAENTMRELAVREGIFCGVSSG----GAVAGALRVAKANPDAVVVAIICD
3dnfB           --------NTYHIETAEELQP---EWFRGVKRVGISAGASTPDWIIEQVKSRIQ----------------
2bhsA           YLPGIFNASLVDEVLDIHQRDAENTMRELAVREGIFCGVSSGGAVAGALRVAKA----NPDAVVVAIICD
1ayxA           GPLLTHDIGSSSTPFDVDNEYVLQSYYLLLEDNKDRYSVNSAYSAGAAI---GRYPEDVYNGDGSSEGNP
3dwgA           FVPELYDPEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVAD
2bhtA           YLPGIFNASLVDEVLDIHQRDAENTMRELAVREGIFCGVSSG----GAVAGALRVAKANPDAVVVAIICD
2bhtB           YLPGIFNASLVDEVLDIHQRDAENTMRELAVREGIFCGVSSGGAVAGALRVAKA----NPDAVVVAIICD
3dkiA           FVPELYDPEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVAD
3dwiB           ------------ARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVAD
3dwgB           FVPELYDPEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVAD
2bhtD           YLPGIFNASLVDEVLDIHQRDAENTMRELAVREGIFCGVSSG----GAVAGALRVAKANPDAVVVAIICD
3dkiB           -------------RYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVAD
3dwiA           ------------------AVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVAD
2eguA           ----------------VTTEEAFAAARRAAREEGILGGISSGAAIHAALKVAKE---LGKGKKVLAIING
2di4A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TGYFDMKAYDAYNRGEMSDHVPTDEELEAGFASIPHIEGxx
2cllB           RGDKDIFTVHDI-----------------------------
1a5sB           RGDKDIFTV--------------------------------
2clmB           RGDKDIFTVHDILKA--------------------------
2cleB           RGDKDIFTVHDILKAR-------------------------
2dh5A           RGDKDIFTVHDI-----------------------------
1a5aB           RGDKDIFTVHDI-----------------------------
1bksB           RGDKDIFTVHDI-----------------------------
2cloB           RGDKDIFTVHDI-----------------------------
2dh6A           RGDKDIFTVHDI-----------------------------
2d1fA           NGLKDPDTA--------------------------------
2c2bA           HGLKFTQSKIDYHSNAIPDMACRFSNPP-------------
2c2bC           HGLKFTQSKIDYHSNAIPDMACRFSNPP-------------
1e5xA           HGLKFTQSKIDYHSNAIPD----------------------
2c2bE           HGLKFTQSKIDYHSNAIPD----------------------
3bm5B           CGERYLSTDLYK----IKDEGTKIQILDS------------
2c2gB           HGLKFTQSKIDYHSNAIPDMACRPVDVKADFGAV-------
2c2bB           HGLKFTQSKIDYHSNAIPDMACPPVDVKADFGAVMDV----
1e5xB           HGLKFTQSKIDYHSNAIPD----ACRFSNPPVDVKADFG--
2c2gA           HGLKFTQSKIDYHSNAIPDMACRFSNP--------------
1d6sA           SGYLSTALFADLFTE--------------------------
2bhtC           RGDRYLSTG--------------------------------
2bhsB           RGDRYLSTG--------------------------------
3dnfB           -----------------------------------------
2bhsA           RGDRYLSTG--------------------------------
1ayxA           WFLATAYAAQVPYKL--------------------------
3dwgA           AGWKYLSTG--AYAGSLDDA---------------------
2bhtA           RGDRYLTGVFG------------------------------
2bhtB           RGDRYL-----------------------------------
3dkiA           AGWKYLSAYAGS-----------------------------
3dwiB           AGWKYLTGAYA------------------------------
3dwgB           AGWKYLSTG--AYAGSLDDA---------------------
2bhtD           RGDRYL-----------------------------------
3dkiB           AGWKYLSTG--AYAGSLDDA---------------------
3dwiA           AGWKYLSTG--------------------------------
2eguA           ERYLSTPLYQ-------------------------------
2di4A           -----------------------------------------