[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55248.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d5iA.bssp"
#ERROR : Can't open dsspfile "2b3dA.bssp"
#ERROR : Can't open dsspfile "3b6mA.bssp"
#ERROR : Can't open dsspfile "3b6mB.bssp"
#ERROR : Can't open dsspfile "3b6iA.bssp"
#ERROR : Can't open dsspfile "1dxqA.bssp"
#ERROR : Can't open dsspfile "2b3dB.bssp"
#ERROR : Can't open dsspfile "2amjC.bssp"
#ERROR : Can't open dsspfile "3brcA.bssp"
#ERROR : Can't open dsspfile "3brcB.bssp"
#ERROR : Can't open dsspfile "3edoB.bssp"
#ERROR : Can't open dsspfile "3edoA.bssp"
#ERROR : Can't open dsspfile "2a5lB.bssp"
#ERROR : Can't open dsspfile "2amjD.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "2amjB.bssp"
#ERROR : Can't open dsspfile "1aktA.bssp"
#ERROR : Can't open dsspfile "2a5lA.bssp"
#ERROR : Can't open dsspfile "2amjA.bssp"
#ERROR : Can't open dsspfile "2arkF.bssp"
#ERROR : Can't open dsspfile "2arkA.bssp"
#ERROR : Can't open dsspfile "2arkB.bssp"
#ERROR : Can't open dsspfile "2arkC.bssp"
#ERROR : Can't open dsspfile "3d7nA.bssp"

## Summary of PDB Search
:187
    4e-21  20%  2d5iA  [x.x.x] AZO REDUCTASE
    6e-18  13%  2b3dA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    2e-17  13%  3b6mA  [x.x.x] FLAVOPROTEIN WRBA
    4e-16  13%  3b6mB  [x.x.x] FLAVOPROTEIN WRBA
    3e-15  17%  3b6iA  [x.x.x] FLAVOPROTEIN WRBA
    8e-15  16%  1dxqA  [c.23.5] QUINONE REDUCTASE
    2e-14  14%  2b3dB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    4e-14  14%  2amjC  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    4e-12  12%  3brcA  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    5e-12  11%  3brcB  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    1e-11  12%  3edoB  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    2e-11  15%  3edoA  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    1e-10  22%  2a5lB  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    2e-10  12%  2amjD  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    4e-10  18%  1d4aA  [c.23.5] QUINONE REDUCTASE
    5e-08  12%  2amjB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    9e-08  18%  1aktA  [x.x.x] FLAVODOXIN
    2e-07  24%  2a5lA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    3e-07  12%  2amjA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    2e-06  17%  2arkF  [x.x.x] FLAVODOXIN
    2e-06  16%  2arkA  [x.x.x] FLAVODOXIN
    7e-06  16%  2arkB  [x.x.x] FLAVODOXIN
    9e-06  17%  2arkC  [x.x.x] FLAVODOXIN
    2e-05  15%  3d7nA  [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN
:187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMRVREAVREAD
2d5iA           -KVLVLKSSILGYSQSNQLSDYFVEQWREKHSEITVRDLAANPIPVLDGELQQEALALSDELIAELKAHD
2b3dA           -NILIINGAKKFAHSNGQLNDTLTEVADGTLRDLGHDV----------RIVRADSDYDVKAEVQNFLWAD
3b6mA           -KVLVLYYSMYGHIETMARAVAEGASKVDGA-EVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYD
3b6mB           -KVLVLYYSMYGHIETMARAVAEGASKVDGA-EVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYD
3b6iA           -KVLVLYYSMYGHIETMARAVAEGASKVDGA-EVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYD
1dxqA           -RALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLLYAMNFNPIESSLAYKEGRLSPDIVAEHKKLEAAD
2b3dB           -NILIINGAKKFAHSNGQLNDTLTEVADGTLRDL---GHDVRIVRADSDY-------DVKAEVQNFLWAD
2amjC           -NILIINGA---KQLNDTLTEVADGTLRDLGHDV--------------RIVRADSDYDVKAEVQNFLWAD
3brcA           -----------EDLIGKAYLESAE----DRRRRSEEVEAIRKYIRSARRTVVPVDAINDVLRSFNLREAE
3brcB           ------------DLIGKAYLESAEDRRRGD--RSEEVEAIRKYIRSARRTVVPVDAINDVLRSFNLREAE
3edoB           -KTLILYYSW--SGETKKAEKINSEIKDSELKEVKVSEGTDYKTSDIALDQIQGDFPEIQLDNIDYNNYD
3edoA           -KTLILYYSWS--GETKKAEKINSEIKDSELKEVKVSEGTFDADIALDQIQGNKDFPEIQLDNIDYNNYD
2a5lB           -YILVLYYSR---HGATAEARQIARGVEQ------------GGFEARVRTVPAVSTEALYATLEDLKNCA
2amjD           SNILIINGAKNDTLTEDGTLRDLGHDVRIVRA---------------------DSDYDVKAEVQNFLWAD
1d4aA           -RALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVEPIISRKDITGKLKDPANFQYPAIVAEQKKLEAAD
2amjB           -NILIINGANG--QLNDTLTEVADGTLRDLGHD--------------VRIVRADSDYDVKAEVQNFLWAD
1aktA           -KALIVYGSTTGNT--EYTAETIARELADAG--------------YEVDSRDAASVEAGG----LFEGFD
2a5lA           -YILVLYYSR---HGATAEARQIARGVEQGGFEA----------RVRTVPAVSTALYATL---EDLKNCA
2amjA           -NILIINGAKG--QLNDTLTEVADGTLRDLGHD--------------VRIVRADSDYDVKAEVQNFLWAD
2arkF           -KVLVIYDTRTGNT--KKAELVAEGARSLEGTEV-----RLKHVDEATKE--------------DVLWAD
2arkA           ---------------------------------------------------------------EDVLWAD
2arkB           ---------------------------------------------------------------EDVLWAD
2arkC           -KVLVIYDTRTGNT--KKAELVAEGARSLEGTEV-----RLKHVDEATKE--------------DVLWAD
3d7nA           -------------------------------------------------------GNLSEDGWAALDAAD


                         .         .         *         .         .         .         .:140
query           GLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGASHAQDQLVGMLSFLDAH
2d5iA           VIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYGLVTGKKAIVITSRGGIHKTDLVTPYLSTFLGFIGIT
2b3dA           VVIWQMPGWWMGAPWTVKKYIDDVFTE--GHGTLYASDGRTRKDPSKKYGSGGLVQGKKYMLSLTWNAPM
3b6mA           AIIFGTPTRFGNMSGQMRTFLDQTGGLW---ASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMV
3b6mB           AIIFGTPTRFGNMSGQMRTFLDQTGGLW---ASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMV
3b6iA           AIIFGTPTRFGNMSGQMRTFLDQTGGLW---ASGALYGKLASV----FSSTGTGGGQEQTI---------
1dxqA           LVIFQFPLQWFGVPAILKGWFERVLVA-------------------------------------------
2b3dB           VVIWQMPGWWMGAPWTVKKYIDDVFTEG---HGTLYASDGRTDPSKK-YGSGGLVQGKKYMLSLTWNAPM
2amjC           VVIW--QPGWWGAPWTVKKYIDDVFTEGHGYGSGGLVQGKKYLSLTWNAPEAFTEKDQFFHGVGVDGVYL
3brcA           HLQFNTNWADLTRPAVTKALALDISGADLVIALGVPGSGSLLVIDSRGRLSAASPPHVIHSEVREAVRSE
3brcB           HLQFNTNWADLTRPAVTKALALDISGADLVGRLGVPGSGSLLVIDSRGRLLSAASPPHVIHSEVREA---
3edoB           LILIGSPVWSGYPATPIKTLLDQKN----------YRGEVASFFTSAGTNHKAYVSHNEWADGLNVIGVA
3edoA           LILIGSPVWSGYPATPIKTLLDQKN----------YRGEVASFFTSAGTNHKASHFNEWADGLN------
2a5lB           GLALGSPTRF-GNASPLKYFLDGTSSLW---LTGSLVGKPAAVFTSTASLHG------------------
2amjD           VVIW--QPGWWGAPWTVKKYIDDVFTEGHGYGSGGLVQGKKYLSLTWNAPEAFTEKDQFFHGVGVDGVYL
1d4aA           LVIFQFPLQWFGVPAILKGWFERVFIGAAMYDKGPFRSKKAVLTGGSGSMYSLQGIHGDMNVILWPIQSG
2amjB           VVIWQPGWWGA--PWTVKKYIDDVFTEG---HGTLYASDGRTKYGSGGLVQGKKYLSLTWNAPEAFTEKD
1aktA           LVLLGCSTWNDDSIELQDDFIPLFDSL----EETGAQGRKVACFGCGDSSYEFCGAVDAIEEKLKNLGAE
2a5lA           GLALGSPTRFG-NASPLKYFLDGTSSLW---LTGSLVGKPAAVFTSTASLHG-----GQETTQLSLL---
2amjA           VVI--WQPGWWGAPWTVKKYIDDVFTEGHGYASDGRKYGSGGLVQGKKYLSLTWNAPEAFTEKDQFFHGV
2arkF           GLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWGGGNEVACSILTLNFGFLVF
2arkA           GLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWGGGNEVACSILTLNFGFLVF
2arkB           GLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWGGGNEVACSILTLNFGFLVF
2arkC           GLAVGSPTNGL-VSWKKRFFDDVLGDLWGE-----IDGKIACAFSSSGGWGGGNEVACSILTLNFGFLVF
3d7nA           AIIFGTPTYG-GPSWQFKKFADASSKPWFSAK---WQDKVFGGFTNSASLNGDKLNTQYLVLLAGQHGGL


                         +         .         .         .         .         *         .:210
query           VMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVERxxx
2d5iA           DVKFVFAEGPEMAAKAQSDAKAAIDS---------------------
2b3dA           EAFTEKDQFFH-GVGVDGVYLP-------------------------
3b6mA           IVPIGYAAQGGATTIAGGDGSRQPQEELSIARYQGEYVAGLAVK---
3b6mB           IVPIG-YAAQEGGTPYGATTIAGGDGSRQPSQEELSIARYQGEY---
3b6iA           -----------------------------------------------
1dxqA           -----------------------------------------------
2b3dB           EA---------------------------------------------
2amjC           PFHKAFLGEPLPTFIANDVIKPDVPRYTEEYRKHLVEIF--------
3brcA           THA--------------------------------------------
3brcB           -----------------------------------------------
3edoB           RD---------------------------------------------
3edoA           -----------------------------------------------
2a5lB           -----------------------------------------------
2amjD           PFHKAFLGEPLPTFIANDVIKPDVPRYTEEYRKHLVEIF--------
1d4aA           ILH--------------------------------------------
2amjB           QFF-HGVGVDGVYLPEPLPTFIANDVIKPDVPRYTEEYRKHLVE---
1aktA           IVQDG------------------------------------------
2a5lA           -----------------------------------------------
2amjA           GVDGVYLPFHKANQFEPLPTFIANDVIKPDVPRYTEEYRKHLVE---
2arkF           GVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAI---
2arkA           GVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAI---
2arkB           GVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAI---
2arkC           GVTDYVGKKFTLHYGAVVAGEPRSEEEKEACRRLGRRLAEWVAI---
3d7nA           WVSLGYIAPAQSESVGDLET---------------------------