[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55343.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dnvB.bssp"
#ERROR : Can't open dsspfile "2b5aA.bssp"
#ERROR : Can't open dsspfile "3clcA.bssp"
#ERROR : Can't open dsspfile "3clcB.bssp"
#ERROR : Can't open dsspfile "2b5aC.bssp"
#ERROR : Can't open dsspfile "2ao9G.bssp"
#ERROR : Can't open dsspfile "1d1lA.bssp"
#ERROR : Can't open dsspfile "2b5aB.bssp"
#ERROR : Can't open dsspfile "2ebyA.bssp"
#ERROR : Can't open dsspfile "2ebyB.bssp"
#ERROR : Can't open dsspfile "2ecsA.bssp"
#ERROR : Can't open dsspfile "2csfA.bssp"
#ERROR : Can't open dsspfile "3d1nN.bssp"
#ERROR : Can't open dsspfile "3b7hA.bssp"
#ERROR : Can't open dsspfile "2ao9D.bssp"
#ERROR : Can't open dsspfile "1b0nA.bssp"
#ERROR : Can't open dsspfile "5croA.bssp"
#ERROR : Can't open dsspfile "2ao9A.bssp"
#ERROR : Can't open dsspfile "3croR.bssp"
#ERROR : Can't open dsspfile "2a6cA.bssp"
#ERROR : Can't open dsspfile "2aw6A.bssp"
#ERROR : Can't open dsspfile "3croL.bssp"
#ERROR : Can't open dsspfile "2axuC.bssp"
#ERROR : Can't open dsspfile "2croA.bssp"
#ERROR : Can't open dsspfile "3d1nP.bssp"
#ERROR : Can't open dsspfile "1adrA.bssp"
#ERROR : Can't open dsspfile "2axuK.bssp"
#ERROR : Can't open dsspfile "2a63A.bssp"
#ERROR : Can't open dsspfile "1copD.bssp"
#ERROR : Can't open dsspfile "2axuG.bssp"
#ERROR : Can't open dsspfile "2axuD.bssp"
#ERROR : Can't open dsspfile "2aw6B.bssp"
#ERROR : Can't open dsspfile "2awiG.bssp"
#ERROR : Can't open dsspfile "2awiA.bssp"
#ERROR : Can't open dsspfile "2ef8A.bssp"
#ERROR : Can't open dsspfile "2axuF.bssp"
#ERROR : Can't open dsspfile "6croA.bssp"
#ERROR : Can't open dsspfile "5croO.bssp"
#ERROR : Can't open dsspfile "3bs3A.bssp"
#ERROR : Can't open dsspfile "2axvB.bssp"
#ERROR : Can't open dsspfile "2ef8B.bssp"
#ERROR : Can't open dsspfile "2axzA.bssp"
#ERROR : Can't open dsspfile "2axuL.bssp"
#ERROR : Can't open dsspfile "2awiC.bssp"
#ERROR : Can't open dsspfile "3bd1A.bssp"
#ERROR : Can't open dsspfile "2bnmA.bssp"
#ERROR : Can't open dsspfile "3bd1C.bssp"
#ERROR : Can't open dsspfile "2axuA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2axuJ.bssp"
#ERROR : Can't open dsspfile "3bd1B.bssp"
#ERROR : Can't open dsspfile "3bdnA.bssp"
#ERROR : Can't open dsspfile "2bnnB.bssp"
#ERROR : Can't open dsspfile "2bnoA.bssp"
#ERROR : Can't open dsspfile "2axuE.bssp"

## Summary of PDB Search
:71
    7e-09  16%  3dnvB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR HIPB
    1e-08  21%  2b5aA  [x.x.x] C.BCLI
    1e-08  22%  3clcA  [x.x.x] REGULATORY PROTEIN
    1e-08  22%  3clcB  [x.x.x] REGULATORY PROTEIN
    2e-08  21%  2b5aC  [x.x.x] C.BCLI
    2e-08  14%  2ao9G  [x.x.x] PHAGE PROTEIN
    3e-08   9%  1d1lA  [a.35.1] LAMBDA CRO REPRESSOR
    6e-08  21%  2b5aB  [x.x.x] C.BCLI
    7e-08  11%  2ebyA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR YBAQ
    9e-08  11%  2ebyB  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR YBAQ
    1e-07  10%  2ecsA  [x.x.x] PHAGE LAMBDA CRO
    1e-07  10%  2csfA  [x.x.x] DNA-BINDING PROTEIN SATB2
    1e-07  13%  3d1nN  [x.x.x] POU DOMAIN, CLASS 6, TRANSCRIPTION FACTOR 1
    1e-07  25%  3b7hA  [x.x.x] PROPHAGE LP1 PROTEIN 11
    1e-07  14%  2ao9D  [x.x.x] PHAGE PROTEIN
    2e-07  29%  1b0nA  [a.35.1 - a.34.1] PROTEIN (SINR PROTEIN)
    2e-07   9%  5croA  [a.35.1] CRO REPRESSOR PROTEIN
    2e-07  14%  2ao9A  [x.x.x] PHAGE PROTEIN
    2e-07  25%  3croR  [a.35.1] PROTEIN (434 CRO)
    3e-07  16%  2a6cA  [x.x.x] HELIX-TURN-HELIX MOTIF
    3e-07  13%  2aw6A  [x.x.x] PRGX
    4e-07  25%  3croL  [a.35.1] PROTEIN (434 CRO)
    4e-07  15%  2axuC  [x.x.x] PRGX
    5e-07  25%  2croA  [x.x.x] REGULATORY PROTEIN CRO
    8e-07  13%  3d1nP  [x.x.x] POU DOMAIN, CLASS 6, TRANSCRIPTION FACTOR 1
    9e-07  19%  1adrA  [x.x.x] P22 C2 REPRESSOR
    1e-06  15%  2axuK  [x.x.x] PRGX
    1e-06  10%  2a63A  [x.x.x] REGULATORY PROTEIN CRO
    2e-06  10%  1copD  [a.35.1] CRO REPRESSOR
    2e-06  15%  2axuG  [x.x.x] PRGX
    2e-06  16%  2axuD  [x.x.x] PRGX
    3e-06  13%  2aw6B  [x.x.x] PRGX
    3e-06  15%  2awiG  [x.x.x] PRGX
    4e-06  16%  2awiA  [x.x.x] PRGX
    5e-06  28%  2ef8A  [x.x.x] PUTATIVE TRANSCRIPTION FACTOR
    6e-06  16%  2axuF  [x.x.x] PRGX
    7e-06  10%  6croA  [a.35.1] LAMBDA CRO REPRESSOR
    8e-06  12%  5croO  [a.35.1] CRO REPRESSOR PROTEIN
    8e-06  22%  3bs3A  [x.x.x] PUTATIVE DNA-BINDING PROTEIN
    1e-05  13%  2axvB  [x.x.x] PRGX
    1e-05  28%  2ef8B  [x.x.x] PUTATIVE TRANSCRIPTION FACTOR
    2e-05  15%  2axzA  [x.x.x] PRGX
    3e-05  15%  2axuL  [x.x.x] PRGX
    4e-05  17%  2awiC  [x.x.x] PRGX
    5e-05  15%  3bd1A  [x.x.x] CRO PROTEIN
    5e-05  19%  2bnmA  [x.x.x] EPOXIDASE
    7e-05  14%  3bd1C  [x.x.x] CRO PROTEIN
    9e-05  17%  2axuA  [x.x.x] PRGX
    9e-05  17%  2axzC  [x.x.x] PRGX
    1e-04  17%  2axuJ  [x.x.x] PRGX
    1e-04  14%  3bd1B  [x.x.x] CRO PROTEIN
    2e-04  24%  3bdnA  [x.x.x] LAMBDA REPRESSOR
    3e-04  19%  2bnnB  [x.x.x] EPOXIDASE
    3e-04  19%  2bnoA  [x.x.x] EPOXIDASE
    9e-04  15%  2axuE  [x.x.x] PRGX
:71

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSDGRRIILGKTIKMLREEQHLSQRRFALMVGTNQTHLWQIECGQVSVGIDLLCRIADGLDIKVKDLID
3dnvB           ------PTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCD-
2b5aA           INEIEIKRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFR
3clcA           ------LSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFE
3clcB           ------LSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFE
2b5aC           INEIEIKRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFR
2ao9G           LTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDIAFKSEVADSFLAEKREQVYSK
1d1lA           ---------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAE--------
2b5aB           INEIEIKRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFR
2ebyA           --------PGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWL-
2ebyB           --------PGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWL-
2ecsA           ---------MEQRITLKDYAMRFGQTKTAKDLGVYPSSINQAIHAGRKIFLTINADGSVYAE----EVKP
2csfA           GANINITAAIYDEIQQEMKRAKVSQALFKVAANKSQGWLCELLRWKENPSPENRTLWENLCTIRRFLNLP
3d1nN           ---------FAKNFKIRRLSLGLTQTQVGQATATEGPAYSQSAISRFDITPKSAQKLKPVLEKWLNEAE-
3b7hA           ---------VSEHLMELITQQNLTINRVATLAGLNQSTVNAMFEGRKRPTITTIRKVCGTLGISVHDFFD
2ao9D           LTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDIAFKSEVADSFLAEKREQVYSK
1b0nA           --------MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTPSIQFLEKVSAVLDVSVHTLLD
5croA           ---------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAE--------
2ao9A           LTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDIAFKSEVADSFLAEKREQVYSK
3croR           ---------LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGV-TKRPRFLFEIAMALNCDPVWLQ-
2a6cA           -----KRSQLLIVLQEHLRNSGLTQFKAAELLGVTQPRVSDLRGKIDLFSLESLIDITSIGL--------
2aw6A           ---------IGSVLKQIRQELNYHQIDLY-SGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
3croL           ---------LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGV-TKRPRFLFEIAMALNCDPVWLQY
2axuC           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2croA           ---------LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGV-TKRPRFLFEIAMALNCDPVWLQ-
3d1nP           ---------FAKNFKIRRLSLGLTQTQVGQATAYSQSAISRFEKLDIT--PKSAQKLKPVLEKWLNEAEL
1adrA           ---------MGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLK
2axuK           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2a63A           ---------MEQRITLKDYAMRFGQTKTAKDLGVQQSAINKWIHAGRKIFLT----INADGSVYAEEVKP
1copD           ---------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADG-------------
2axuG           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2axuD           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEIL-
2aw6B           ---------IGSVLKQIRQELNYHQIDLY-SGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2awiG           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2awiA           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEI--
2ef8A           ------RYRLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIESFERRLDFELLEVVASRLGLPMDILLK
2axuF           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEIL-
6croA           -------------ITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAE--------
5croO           ---------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLT----INADGSVYAEEVKP
3bs3A           -------------IKVVLAEKQRTNRWLA-EQGKSENTISRWCSNKSQPSLDLV-KVAELLNVDPRQLIN
2axvB           ---------IGSVLKQIRQELNYHQIDLY-SGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2ef8B           ------RYRLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIESFERRLDFELLEVVASRLGLPMDILLK
2axzA           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2axuL           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
2awiC           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNF-----
3bd1A           -------------IDIAIN-KLGSVSALAASLGVRQSAISNWRARG-RVPAERCIDIERVTNGAVICR--
2bnmA           ---------FAELLKDRREQVKMDHAALASLLGETPETVAAWENGE------------------------
3bd1C           -------------IDIAIN-KLGSVSALAASLGVRQSAISNWRARG-RVPAERCIDIERVTNGAVICREL
2axuA           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGV-------
2axzC           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGV-------
2axuJ           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGV-------
3bd1B           -------------IDIAIN-KLGSVSALAASLGVRQSAISNWRARG-RVPAERCIDIERVTNGAVICREL
3bdnA           ---------LKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGI------------------------
2bnnB           ---------FAELLKDRREQVKMDHAALASLLGETPETVAAWENGE------------------------
2bnoA           ---------FAELLKDRREQVKMDHAALASLLGETPETVAAWENGE------------------------
2axuE           ---------IGSVLKQIRQELNYHQIDLY--SGISKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN


                         .         .         *         .         .         .         .:140
query           F
3dnvB           -
2b5aA           -
3clcA           -
3clcB           -
2b5aC           -
2ao9G           -
1d1lA           -
2b5aB           -
2ebyA           -
2ebyB           -
2ecsA           F
2csfA           -
3d1nN           -
3b7hA           -
2ao9D           L
1b0nA           E
5croA           -
2ao9A           L
3croR           -
2a6cA           -
2aw6A           R
3croL           -
2axuC           R
2croA           -
3d1nP           R
1adrA           G
2axuK           -
2a63A           D
1copD           -
2axuG           -
2axuD           -
2aw6B           -
2awiG           R
2awiA           -
2ef8A           D
2axuF           -
6croA           -
5croO           F
3bs3A           -
2axvB           -
2ef8B           D
2axzA           R
2axuL           R
2awiC           -
3bd1A           -
2bnmA           -
3bd1C           R
2axuA           -
2axzC           -
2axuJ           -
3bd1B           R
3bdnA           -
2bnnB           -
2bnoA           -
2axuE           R