[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55454.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3e0cA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2bnlB.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2bnlA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1d0sA.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "3co5B.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2bnlC.bssp"
#ERROR : Can't open dsspfile "1akyA.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2dhrF.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2bnlB.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2bnlA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"

## Summary of PDB Search
:1228
    2e-63  43%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-61  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA[MASQUE
    9e-45  22%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-43   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-42  11%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-42  12%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    5e-42  10%  3cmvG  [x.x.x] PROTEIN RECA
    8e-42  13%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-41  12%  2akaB  [x.x.x] DYNAMIN-1
    3e-41  18%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-41   7%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-41  12%  3cmvH  [x.x.x] PROTEIN RECA
    1e-39  13%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    4e-39  11%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-38  12%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-38  11%  3cmvC  [x.x.x] PROTEIN RECA
    1e-37  11%  2b8tA  [x.x.x] THYMIDINE KINASE
    3e-37  12%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    3e-37  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    3e-37  18%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    3e-36  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-35  14%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    1e-35  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-35  13%  3cmvA  [x.x.x] PROTEIN RECA
    5e-35  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-35  10%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-34  12%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    2e-34  15%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    2e-34   8%  4dcgA  [x.x.x] VP39
    3e-34  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-34  12%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    4e-34  12%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    6e-34  12%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    1e-33  12%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-33  11%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-33  14%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-33  10%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-33  11%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-33  14%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    9e-33  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    1e-32   9%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    2e-32  11%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    6e-32  14%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    8e-32   9%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    8e-32  22%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-31  10%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    5e-31  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    5e-31  10%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    9e-31  11%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-30  13%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-30   6%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-30   9%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    5e-30  11%  2cgtH  [x.x.x] 60 KDA GROEL
    5e-30   6%  2bifA  [c.37.1 - c.60.1] PROTEIN
    1e-29  11%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-29  17%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    2e-29  21%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-29  16%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    6e-29  12%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    1e-28  12%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    4e-28   7%  2c4rL  [x.x.x] RIBONUCLEASE E
    4e-28  11%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    5e-28  11%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-28  11%  1aroP  [e.8.1] T7 RNA POLYMERASE
    7e-28  15%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-28  15%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    8e-28  13%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    9e-28  10%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    9e-28  14%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    1e-27   8%  2ctsA  [x.x.x] CITRATE SYNTHASE
    2e-27   5%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-27  30%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-27   7%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-27  15%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-27   9%  2c9oC  [x.x.x] RUVB-LIKE 1
    7e-27  12%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-26  11%  2cckA  [x.x.x] THYMIDYLATE KINASE
    1e-26  12%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    1e-26  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-26  14%  2axzC  [x.x.x] PRGX
    1e-26  12%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-26   9%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-26   8%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-25  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-25  12%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-25   8%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-25  12%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    2e-25  10%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    3e-25  12%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    6e-25   8%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    7e-25  11%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-25  13%  3da4A  [x.x.x] COLICIN-M
    1e-24  14%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-24  12%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-24   8%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    2e-24  12%  1e6cA  [c.37.1] SHIKIMATE KINASE
    2e-24  14%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-24  14%  3ec1A  [x.x.x] YQEH GTPASE
    2e-24   9%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-24  11%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-24  11%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-24  11%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-24   9%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-24  14%  2b8tB  [x.x.x] THYMIDINE KINASE
    4e-24  13%  3bm2B  [x.x.x] PROTEIN YDJA
    4e-24  12%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-24  10%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    5e-24  10%  421pA  [x.x.x] H-RAS P21 PROTEIN
    6e-24  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    6e-24  14%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-23  13%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-23   8%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-23   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-23  12%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    3e-23  13%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-23  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    5e-23  14%  1e0jA  [c.37.1] DNA HELICASE
    6e-23  13%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-23  13%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-22  13%  1e0jB  [c.37.1] DNA HELICASE
    1e-22  14%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    2e-22  11%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-22  13%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    3e-22  23%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-22  19%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-22  11%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    5e-22  13%  3c8uA  [x.x.x] FRUCTOKINASE
    5e-22  14%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    6e-22  23%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-22   9%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    9e-22  13%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    9e-22  11%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    9e-22   9%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    1e-21  20%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-21  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-21  12%  3cmvB  [x.x.x] PROTEIN RECA
    3e-21  11%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    4e-21  14%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-21  12%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    4e-21  13%  3cmxA  [x.x.x] PROTEIN RECA
    5e-21  18%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    5e-21  17%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    5e-21   9%  3bczC  [x.x.x] PROTEIN MEMO1
    5e-21  22%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    6e-21  14%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    8e-21  13%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    8e-21   9%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-20  13%  2bdtA  [x.x.x] BH3686
    1e-20  10%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    2e-20   9%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    3e-20  13%  2cckB  [x.x.x] THYMIDYLATE KINASE
    3e-20   9%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    4e-20  14%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-20   9%  2b8tC  [x.x.x] THYMIDINE KINASE
    4e-20  17%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    4e-20  14%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-20   9%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-20  12%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    6e-20  15%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    6e-20   8%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    8e-20  12%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    8e-20  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    1e-19  10%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-19  13%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    1e-19  14%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-19  13%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-19  12%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-19  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-19  23%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-19   9%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-19  14%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-19  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    4e-19  13%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-19  24%  2d2fA  [x.x.x] SUFC PROTEIN
    4e-19  14%  2bhvD  [x.x.x] COMB10
    6e-19  10%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    6e-19   9%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    7e-19  11%  3cmvE  [x.x.x] PROTEIN RECA
    8e-19  11%  3adkA  [x.x.x] ADENYLATE KINASE
    9e-19   9%  2bx2L  [x.x.x] RIBONUCLEASE E
    1e-18  11%  3a00A  [x.x.x] GUANYLATE KINASE
    1e-18  15%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-18  23%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-18  10%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-18  23%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    2e-18  14%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-18  22%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-18  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    3e-18  16%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    3e-18  14%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    4e-18  14%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    4e-18  10%  1e2iA  [c.37.1] THYMIDINE KINASE
    4e-18  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    5e-18  17%  3cm0A  [x.x.x] ADENYLATE KINASE
    5e-18  17%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-18  11%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    6e-18  14%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-18  12%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-18  13%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    7e-18  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-18  12%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-18  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-17  15%  2a1fF  [x.x.x] URIDYLATE KINASE
    1e-17  11%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-17  12%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-17   9%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-17  26%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    3e-17   9%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    6e-17  13%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    6e-17  15%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    9e-17   8%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-16  15%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-16  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    1e-16  12%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-16  13%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-16  14%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16   9%  3be4A  [x.x.x] ADENYLATE KINASE
    2e-16  11%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-16  11%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    4e-16  14%  1e2hB  [c.37.1] THYMIDINE KINASE
    4e-16  18%  3cmwC  [x.x.x] PROTEIN RECA
    4e-16  15%  2bhvA  [x.x.x] COMB10
    4e-16  13%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-16  27%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-16  12%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    5e-16  10%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    6e-16  13%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-16  13%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-16  13%  3dlbB  [x.x.x] ARGONAUTE
    8e-16   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    9e-16  13%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-15   7%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15  12%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-15   7%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15   7%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15  16%  2a1fD  [x.x.x] URIDYLATE KINASE
    2e-15  25%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-15  17%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-15   7%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-15   7%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-15  15%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-15  14%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-15  14%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    8e-15  12%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    8e-15  15%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    8e-15   7%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-15  14%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    9e-15  14%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    1e-14  10%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-14  16%  2dftC  [x.x.x] SHIKIMATE KINASE
    1e-14  16%  2a1fE  [x.x.x] URIDYLATE KINASE
    1e-14  13%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    1e-14  17%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-14  12%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-14   9%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    3e-14  25%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-14  10%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    4e-14  11%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-14  15%  3cmtD  [x.x.x] PROTEIN RECA
    4e-14  11%  3dfdA  [x.x.x] PROTEIN YQBN
    4e-14  10%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    4e-14   8%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    5e-14   9%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    5e-14  13%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    5e-14  20%  2dftA  [x.x.x] SHIKIMATE KINASE
    5e-14   9%  3e0cA  [x.x.x] DNA DAMAGE-BINDING PROTEIN 1
    5e-14   9%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-14   7%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-14   7%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-14  10%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    7e-14   7%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-14  17%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-14  15%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    1e-13   7%  1adoA  [c.1.10] ALDOLASE
    1e-13   7%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-13  12%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-13   9%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    2e-13  14%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-13   9%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    2e-13  14%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-13   7%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    3e-13  21%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    5e-13  14%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    6e-13  13%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-13  12%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    7e-13  17%  3cmuA  [x.x.x] PROTEIN RECA
    8e-13  10%  2c9gA  [x.x.x] PENTON PROTEIN
    8e-13  12%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-12  16%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-12  15%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-12   9%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    2e-12  15%  1e2lA  [c.37.1] THYMIDINE KINASE
    2e-12  14%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-12   8%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-12   9%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-12  14%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-12   7%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-12   9%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    4e-12   9%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    4e-12   7%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-12  15%  1e2iB  [c.37.1] THYMIDINE KINASE
    8e-12  11%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    8e-12  11%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    9e-12  15%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-11  14%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-11   8%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-11  15%  2an9A  [x.x.x] GUANYLATE KINASE
    2e-11   7%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-11  13%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    2e-11  12%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-11   7%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    3e-11   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    4e-11  11%  1eamA  [c.66.1] PROTEIN (VP39)
    5e-11  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    5e-11  10%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    6e-11  14%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-11  13%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    7e-11   7%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    9e-11  14%  2anbA  [x.x.x] GUANYLATE KINASE
    3e-10  18%  2a1fC  [x.x.x] URIDYLATE KINASE
    3e-10  10%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-10  19%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    5e-10  17%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-10  14%  1e2hA  [c.37.1] THYMIDINE KINASE
    7e-10  20%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    9e-10  10%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-09  13%  1e2nB  [c.37.1] THYMIDINE KINASE
    2e-09  12%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-09  20%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-09  15%  2ancB  [x.x.x] GUANYLATE KINASE
    3e-09  19%  2bhvC  [x.x.x] COMB10
    4e-09  14%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    4e-09  19%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    5e-09   5%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    5e-09  14%  2c9oA  [x.x.x] RUVB-LIKE 1
    6e-09  16%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    7e-09  16%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-08  14%  1e2nA  [c.37.1] THYMIDINE KINASE
    4e-08  17%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    4e-08  15%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    5e-08  20%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    5e-08  15%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    7e-08  11%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    7e-08  16%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    8e-08  15%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    8e-08  16%  2c5mD  [x.x.x] CTP SYNTHASE
    1e-07  35%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-07   9%  2bnlB  [x.x.x] MODULATOR PROTEIN RSBR
    2e-07  17%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-07  10%  2cdnA  [x.x.x] ADENYLATE KINASE
    2e-07  26%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  13%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    2e-07  16%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-07  15%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I
    3e-07  16%  1e2mA  [c.37.1] THYMIDINE KINASE
    3e-07  14%  1e2lB  [c.37.1] THYMIDINE KINASE
    3e-07  13%  2c9oB  [x.x.x] RUVB-LIKE 1
    4e-07  20%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-07  19%  3dkvA  [x.x.x] ADENYLATE KINASE
    7e-07  20%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    7e-07  19%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-06   7%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    1e-06  12%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    1e-06   8%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    2e-06  11%  2bnlA  [x.x.x] MODULATOR PROTEIN RSBR
    2e-06   9%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    3e-06  16%  1d0sA  [c.39.1] NICOTINATE MONONUCLEOTIDE:5,6-[MASQUE : MEMB(X) 46 /
    3e-06  18%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-06  10%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    9e-06  14%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-05  17%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-05  19%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    4e-05  18%  2c95B  [x.x.x] ADENYLATE KINASE 1
    5e-05  17%  3co5B  [x.x.x] PUTATIVE TWO-COMPONENT SYSTEM TRANSCRIPTIONAL
    6e-05  21%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    7e-05  17%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    9e-05  17%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    1e-04  18%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    2e-04  13%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-04  23%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    5e-04  19%  1chdA  [x.x.x] CHEB METHYLESTERASE
    5e-04   8%  2bnlC  [x.x.x] MODULATOR PROTEIN RSBR
    7e-04  26%  1akyA  [x.x.x] ADENYLATE KINASE
    7e-04  16%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    8e-04  31%  2dhrF  [x.x.x] FTSH
    2e-50  37%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 352->576)
    1e-45  34%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA[MASQUE(query 93->587)
    6e-33  21%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->585)
    5e-36   7%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 348->594)
    1e-24  11%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 322->585)
    2e-27   9%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B(query 326->585)
    1e-36  12%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 326->585)
    8e-35  13%  2akaB  [x.x.x] DYNAMIN-1(query 354->622)
    2e-31  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN(query 368->569)
    3e-34   7%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 366->594)
    6e-24   8%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN(query 322->597)
    4e-24   9%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 340->585)
    1e-27   8%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 202->621)
    7e-28   9%  2b8tA  [x.x.x] THYMIDINE KINASE(query 379->576)
    2e-24   9%  1e9cA  [c.37.1] THYMIDYLATE KINASE(query 379->587)
    1e-24   8%  1d1cA  [c.37.1 - b.34.3] MYOSIN(query 357->585)
    3e-25  17%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM(query 375->564)
    2e-34  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 322->585)
    3e-24  12%  1e9fA  [c.37.1] THYMIDYLATE KINASE(query 379->575)
    2e-31  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 322->585)
    3e-28  11%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 326->587)
    5e-33  14%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN(query 322->576)
    7e-28   5%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I(query 340->542)
    7e-24  12%  2ccgB  [x.x.x] THYMIDYLATE KINASE(query 379->577)
    3e-25   8%  4dcgA  [x.x.x] VP39(query 324->587)
    1e-26   9%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 201->594)
    5e-25  11%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL(query 379->591)
    1e-22  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE(query 379->587)
    1e-25  10%  2ccjB  [x.x.x] THYMIDYLATE KINASE(query 381->583)
    7e-23   8%  1e98A  [c.37.1] THYMIDYLATE KINASE(query 379->590)
    1e-18   9%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 354->585)
    2e-24  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE(query 380->588)
    2e-28   9%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 349->575)
    5e-26  12%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 192->668)
    9e-31  13%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 322->585)
    5e-28   9%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN(query 210->608)
    2e-23   6%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/(query 379->587)
    7e-18   8%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 340->597)
    4e-28  15%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284(query 361->600)
    3e-25  11%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 348->585)
    4e-25  18%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->602)
    1e-22  10%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B(query 322->594)
    5e-24  13%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284(query 358->577)
    3e-22  10%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 331->588)
    6e-21  14%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->636)
    4e-22   5%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3(query 367->558)
    3e-20   8%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE(query 324->594)
    1e-18  11%  2cgtH  [x.x.x] 60 KDA GROEL(query 321->590)
    2e-21   7%  2bifA  [c.37.1 - c.60.1] PROTEIN(query 379->594)
    1e-26   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 201->613)
    5e-23  14%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE(query 352->586)
    1e-23  13%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN(query 367->534)
    2e-20   9%  1e9dA  [c.37.1] THYMIDYLATE KINASE(query 379->586)
    2e-23   7%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF(query 354->585)
    9e-15   7%  2c4rL  [x.x.x] RIBONUCLEASE E(query 359->614)
    6e-21  11%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE(query 379->577)
    2e-17  10%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 322->585)
    5e-17   6%  1aroP  [e.8.1] T7 RNA POLYMERASE(query 442->574)
    2e-19  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 331->547)
    9e-24  12%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1(query 354->581)
    5e-17   7%  2bofX  [x.x.x] ENDOGLUCANASE E-2(query 400->596)
    1e-16  10%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 395->574)
    2e-18  11%  1e2fA  [c.37.1] THYMIDYLATE KINASE(query 379->586)
    1e-18   9%  2ctsA  [x.x.x] CITRATE SYNTHASE(query 360->548)
    9e-18   4%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6(query 382->535)
    7e-17  25%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 358->585)
    1e-22   8%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 350->583)
    4e-20  16%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING(query 350->638)
    2e-23   9%  2c9oC  [x.x.x] RUVB-LIKE 1(query 324->603)
    3e-26   9%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 970->1208)
    2e-19  10%  2cckA  [x.x.x] THYMIDYLATE KINASE(query 381->583)
    9e-15  10%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280(query 380->523)
    1e-22  19%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 353->601)
    4e-17   7%  2axzC  [x.x.x] PRGX(query 471->576)
    8e-19  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 346->549)
    5e-24   8%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 970->1186)
    2e-15   8%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B(query 383->536)
    1e-20   7%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 382->581)
    1e-12  10%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE(query 441->594)
    6e-18  11%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE(query 379->567)
    7e-18   8%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF(query 354->543)
    4e-17  11%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED(query 349->586)
    4e-16  10%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE(query 379->593)
    3e-19  10%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 349->576)
    1e-14   6%  3da4A  [x.x.x] COLICIN-M(query 322->451)
    2e-15   9%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE(query 347->637)
    3e-12  12%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE(query 378->542)
    1e-15   7%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989(query 341->583)
    2e-11   9%  1e6cA  [c.37.1] SHIKIMATE KINASE(query 381->535)
    3e-17  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 346->573)
    9e-16  11%  3ec1A  [x.x.x] YQEH GTPASE(query 367->587)
    7e-22   8%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 350->587)
    6e-19  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 348->597)
    1e-20  11%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284(query 358->576)
    2e-22   9%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 201->594)
    5e-23   8%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 970->1194)
    1e-15  12%  2b8tB  [x.x.x] THYMIDINE KINASE(query 379->576)
    1e-11  11%  3bm2B  [x.x.x] PROTEIN YDJA(query 433->583)
    9e-19  10%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 343->548)
    1e-16  10%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE(query 379->575)
    4e-13  11%  421pA  [x.x.x] H-RAS P21 PROTEIN(query 382->536)
    3e-18   7%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 354->587)
    2e-16  10%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 356->652)
    3e-16  10%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE(query 335->606)
    1e-18   9%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN(query 355->588)
    4e-18   7%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN(query 344->587)
    1e-21   9%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE(query 352->599)
    2e-13  10%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 478->593)
    1e-19  11%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE(query 359->608)
    4e-20  11%  1e0jA  [c.37.1] DNA HELICASE(query 344->588)
    5e-14  13%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE(query 442->593)
    1e-10  13%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE(query 378->541)
    7e-19  11%  1e0jB  [c.37.1] DNA HELICASE(query 341->588)
    1e-18  14%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284(query 361->600)
    3e-14   8%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE(query 350->574)
    5e-17  12%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN(query 319->452)
    7e-17  18%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 347->593)
    2e-17  20%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->584)
    4e-19   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT(query 357->594)
    1e-14  13%  3c8uA  [x.x.x] FRUCTOKINASE(query 358->574)
    5e-17  15%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284(query 358->601)
    7e-14   9%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B(query 369->542)
    4e-17  12%  1e2gA  [c.37.1] THYMIDYLATE KINASE(query 379->586)
    4e-14   7%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN(query 348->560)
    9e-17   9%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE(query 379->567)
    1e-17  21%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->584)
    2e-16  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 326->573)
    2e-13   8%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639(query 407->551)
    2e-11  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 352->452)
    7e-10  18%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 507->557)
    7e-16   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE(query 369->611)
    6e-07  15%  3cmxA  [x.x.x] PROTEIN RECA(query 376->451)
    1e-06  13%  3cmxA  [x.x.x] PROTEIN RECA(query 509->580)
    2e-18  16%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE(query 348->576)
    1e-16  15%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE(query 353->586)
    1e-17   7%  3bczC  [x.x.x] PROTEIN MEMO1(query 369->624)
    7e-18  22%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN(query 352->588)
    3e-13  13%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 379->622)
    2e-12   9%  3ecpA  [x.x.x] TN5 TRANSPOSASE(query 431->587)
    4e-15   7%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE(query 326->597)
    1e-11  12%  2bdtA  [x.x.x] BH3686(query 381->542)
    5e-16   7%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM(query 322->597)
    5e-15  10%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE(query 379->577)
    9e-17  14%  2cckB  [x.x.x] THYMIDYLATE KINASE(query 380->558)
    5e-08   7%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2(query 408->621)
    1e-11   8%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 379->593)
    2e-13   8%  2b8tC  [x.x.x] THYMIDINE KINASE(query 379->575)
    4e-17  15%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE(query 348->577)
    1e-08  15%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE(query 379->541)
    7e-19  10%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 970->1194)
    4e-15   7%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE(query 373->629)
    3e-15  12%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2(query 377->591)
    1e-17   9%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 349->630)
    6e-10  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)(query 512->586)
    1e-12  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB(query 369->563)
    2e-15  18%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 350->448)
    1e-16  12%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284(query 358->576)
    4e-15   9%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 349->574)
    1e-18  15%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 331->452)
    3e-15  12%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE(query 359->597)
    3e-15   9%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 349->587)
    1e-14  17%  2d2eA  [x.x.x] SUFC PROTEIN(query 350->587)
    9e-12   7%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN(query 336->546)
    3e-14  13%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 379->576)
    6e-18  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3(query 340->565)
    4e-16   7%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 383->651)
    3e-15  19%  2d2fA  [x.x.x] SUFC PROTEIN(query 350->587)
    8e-15  10%  2bhvD  [x.x.x] COMB10(query 414->588)
    1e-12  16%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE(query 371->439)
    7e-12   6%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE(query 508->601)
    2e-11  12%  3adkA  [x.x.x] ADENYLATE KINASE(query 373->561)
    2e-10   5%  2bx2L  [x.x.x] RIBONUCLEASE E(query 477->591)
    4e-13  12%  3a00A  [x.x.x] GUANYLATE KINASE(query 383->547)
    2e-11  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 442->593)
    2e-12  23%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 352->584)
    1e-14   7%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE(query 916->1053)
    5e-13  10%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 442->593)
    2e-16  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)(query 347->452)
    1e-10  14%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN(query 471->609)
    4e-12  10%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE(query 442->593)
    3e-13  10%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA(query 515->593)
    1e-06  15%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA(query 304->410)
    2e-13  12%  1e2iA  [c.37.1] THYMIDINE KINASE(query 376->613)
    5e-08  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 367->547)
    8e-11  15%  3cm0A  [x.x.x] ADENYLATE KINASE(query 379->558)
    5e-17  17%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 349->448)
    3e-10  10%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I(query 384->546)
    1e-16  12%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 378->452)
    6e-13   8%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 347->588)
    2e-10  11%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX(query 401->542)
    4e-11  14%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 367->542)
    4e-16  16%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 331->448)
    8e-08  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK(query 370->547)
    2e-11  11%  2a1fF  [x.x.x] URIDYLATE KINASE(query 491->585)
    2e-13  11%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA(query 341->599)
    1e-11  10%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE(query 379->559)
    2e-09   6%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 367->420)
    1e-08   5%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 509->588)
    2e-14  19%  1b0uA  [c.37.1] HISTIDINE PERMEASE(query 352->593)
    1e-12   7%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE(query 374->541)
    1e-09  15%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN(query 471->621)
    6e-12   7%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN(query 434->577)
    1e-09  11%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE(query 474->585)
    1e-12  10%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 442->593)
    3e-12  13%  1e2kA  [c.37.1] THYMIDINE KINASE(query 376->588)
    4e-07  12%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN(query 332->412)
    5e-15  16%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 349->447)
    5e-15  10%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 347->588)
    1e-10   8%  3be4A  [x.x.x] ADENYLATE KINASE(query 376->577)
    6e-10  10%  3a00B  [x.x.x] GUANYLATE KINASE(query 381->547)
    2e-10  10%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)(query 382->453)
    2e-11  10%  1e2hB  [c.37.1] THYMIDINE KINASE(query 376->622)
    1e-14  15%  3cmwC  [x.x.x] PROTEIN RECA(query 367->447)
    1e-11  11%  2bhvA  [x.x.x] COMB10(query 414->574)
    1e-14  16%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 349->450)
    6e-09  14%  2c7cH  [x.x.x] 60 KDA CHAPERONIN(query 490->603)
    1e-12  11%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE(query 401->602)
    9e-16  15%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 997->1068)
    3e-11   9%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE(query 478->597)
    8e-12   8%  3dlbB  [x.x.x] ARGONAUTE(query 374->632)
    7e-09   6%  2c0bL  [x.x.x] RIBONUCLEASE E(query 341->574)
    9e-16  14%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 997->1086)
    1e-09   4%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    1e-10  22%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE(query 358->439)
    5e-07   2%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    5e-07   4%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    4e-10  12%  2a1fD  [x.x.x] URIDYLATE KINASE(query 507->594)
    7e-08  25%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 1133->1207)
    3e-10  12%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 490->593)
    2e-06   4%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    1e-09   4%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->568)
    2e-14  17%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 331->447)
    2e-09   9%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 442->597)
    8e-12   8%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN(query 434->584)
    7e-11  12%  2ccjA  [x.x.x] THYMIDYLATE KINASE(query 381->574)
    4e-08   5%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    5e-13  11%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC(query 507->586)
    5e-12  14%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN(query 478->606)
    2e-08   0%  2b8tD  [x.x.x] THYMIDINE KINASE(query 536->576)
    9e-05  20%  2b8tD  [x.x.x] THYMIDINE KINASE(query 379->403)
    4e-05  11%  2dftC  [x.x.x] SHIKIMATE KINASE(query 381->530)
    3e-09  12%  2a1fE  [x.x.x] URIDYLATE KINASE(query 507->594)
    3e-11  10%  2bwjA  [x.x.x] ADENYLATE KINASE 5(query 372->563)
    2e-09  13%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 442->593)
    6e-11  10%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 383->574)
    3e-09   6%  3dymA  [x.x.x] BETA-GALACTOSIDASE(query 508->573)
    3e-11  22%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 352->576)
    5e-12   9%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN(query 315->437)
    5e-08   8%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 383->576)
    1e-10  12%  3dfdA  [x.x.x] PROTEIN YQBN(query 344->447)
    5e-12  11%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 381->451)
    7e-09   7%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3(query 357->551)
    1e-07   6%  3czjA  [x.x.x] BETA-GALACTOSIDASE(query 489->601)
    3e-10  12%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN(query 339->555)
    2e-06   5%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    1e-06   4%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    8e-07   4%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->569)
    4e-08   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE(query 478->601)
    2e-07   4%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->567)
    1e-13  16%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 973->1066)
    6e-10  13%  1azsC  [c.37.1 - a.66.1] GS-ALPHA(query 376->439)
    2e-09   4%  1adoA  [c.1.10] ALDOLASE(query 490->571)
    2e-07   6%  1aldA  [c.1.10 (2aldA)] ALDOLASE A(query 476->569)
    5e-09  37%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 350->414)
    8e-07   7%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)(query 507->551)
    2e-09  13%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE(query 354->595)
    2e-04   9%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE(query 383->551)
    4e-10  16%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 379->451)
    1e-06   4%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE(query 490->569)
    9e-10  19%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)(query 379->568)
    2e-12  20%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE(query 358->447)
    2e-11   8%  2c9gA  [x.x.x] PENTON PROTEIN(query 964->1026)
    9e-06   9%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN(query 474->571)
    2e-08  15%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 381->450)
    2e-09  10%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT(query 322->392)
    1e-05  16%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT(query 536->585)
    5e-08   9%  1e2lA  [c.37.1] THYMIDINE KINASE(query 376->624)
    5e-11  14%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 376->439)
    7e-12  11%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330(query 341->440)
    2e-10  13%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN(query 322->576)
    8e-06  12%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE(query 490->575)
    4e-11  13%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330(query 336->435)
    1e-05  13%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE(query 381->567)
    2e-08  15%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))(query 342->403)
    2e-06   8%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))(query 514->575)
    2e-06   4%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->571)
    2e-07  11%  1e2iB  [c.37.1] THYMIDINE KINASE(query 376->609)
    5e-04  13%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE(query 475->576)
    1e-06  10%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1(query 375->540)
    1e-07   9%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN(query 474->577)
    3e-06  13%  2ancD  [x.x.x] GUANYLATE KINASE(query 539->577)
    7e-05  34%  2ancD  [x.x.x] GUANYLATE KINASE(query 379->407)
    4e-06   4%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->568)
    2e-06  15%  2an9A  [x.x.x] GUANYLATE KINASE(query 536->576)
    4e-06   4%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 490->574)
    1e-10  12%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE(query 344->417)
    5e-06  31%  2ancF  [x.x.x] GUANYLATE KINASE(query 379->413)
    3e-08  14%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107(query 341->404)
    2e-05   9%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107(query 541->574)
    8e-07  11%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1(query 348->394)
    9e-06   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1(query 509->584)
    4e-10   9%  1eamA  [c.66.1] PROTEIN (VP39)(query 355->575)
    6e-07  11%  1e2jA  [c.37.1] THYMIDINE KINASE(query 376->624)
    1e-06  10%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6(query 379->536)
    5e-10  17%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 378->450)
    1e-04   6%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)(query 509->594)
    1e-10   7%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN(query 903->1065)
    8e-07  11%  2anbA  [x.x.x] GUANYLATE KINASE(query 379->576)
    1e-06  12%  2a1fC  [x.x.x] URIDYLATE KINASE(query 491->586)
    6e-09  16%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 349->426)
    5e-10  20%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 997->1057)
    4e-09  17%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 960->1039)
    1e-07  14%  1e2hA  [c.37.1] THYMIDINE KINASE(query 376->446)
    7e-04  16%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-(query 379->452)
    7e-04   6%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE(query 507->588)
    8e-07  18%  1e2nB  [c.37.1] THYMIDINE KINASE(query 376->424)
    3e-05  26%  1e2mB  [c.37.1] THYMIDINE KINASE(query 376->410)
    1e-05  14%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 378->439)
    8e-06  17%  2ancB  [x.x.x] GUANYLATE KINASE(query 536->576)
    9e-05  40%  2ancB  [x.x.x] GUANYLATE KINASE(query 379->403)
    5e-07  15%  2bhvC  [x.x.x] COMB10(query 414->574)
    5e-09  13%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 378->439)
    5e-08  11%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN(query 1113->1195)
    2e-07  13%  2c9oA  [x.x.x] RUVB-LIKE 1(query 947->1189)
    7e-09  13%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT(query 1001->1052)
    1e-08  14%  1e2kB  [c.37.1] THYMIDINE KINASE(query 995->1122)
    9e-06  22%  1e2nA  [c.37.1] THYMIDINE KINASE(query 376->416)
    2e-07  18%  2bwjD  [x.x.x] ADENYLATE KINASE 5(query 995->1053)
    3e-06  18%  2bwjB  [x.x.x] ADENYLATE KINASE 5(query 991->1028)
    4e-07  16%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC(query 507->586)
    1e-06  14%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 972->1021)
    2e-04  16%  2c5mD  [x.x.x] CTP SYNTHASE(query 509->603)
    2e-07  39%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1(query 534->587)
    6e-06  25%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1(query 972->1023)
    3e-05  12%  2bnlB  [x.x.x] MODULATOR PROTEIN RSBR(query 203->281)
    2e-05  20%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 350->410)
    4e-06  18%  2cdnA  [x.x.x] ADENYLATE KINASE(query 378->448)
    9e-07  14%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 1159->1228)
    6e-06  20%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 972->1021)
    2e-07  16%  1e2jB  [c.37.1] THYMIDINE KINASE(query 996->1094)
    5e-07  13%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I(query 1124->1203)
    2e-06  13%  1e2mA  [c.37.1] THYMIDINE KINASE(query 997->1086)
    6e-06  10%  1e2lB  [c.37.1] THYMIDINE KINASE(query 376->687)
    7e-07  22%  2c9oB  [x.x.x] RUVB-LIKE 1(query 944->1037)
    2e-06  17%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 949->1013)
    4e-06  17%  3dkvA  [x.x.x] ADENYLATE KINASE(query 383->450)
    2e-05  21%  2bwjF  [x.x.x] ADENYLATE KINASE 5(query 995->1028)
    2e-04  23%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-(query 379->448)
    5e-05   8%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE(query 995->1111)
    5e-06  10%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL(query 507->648)
    5e-04   3%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321(query 376->439)
    6e-05  12%  2bnlA  [x.x.x] MODULATOR PROTEIN RSBR(query 203->281)
    2e-04  27%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4(query 382->414)
    3e-05  14%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 999->1122)
    1e-05  16%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 326->392)
    2e-05  12%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 383->449)
    8e-05  21%  2bwjC  [x.x.x] ADENYLATE KINASE 5(query 995->1028)
    5e-04  13%  2c95B  [x.x.x] ADENYLATE KINASE 1(query 995->1186)
    6e-04  14%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A(query 1001->1158)
    1e-04  22%  2bwjE  [x.x.x] ADENYLATE KINASE 5(query 995->1053)
:1228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxLCSHAAAFDAQYRTKLDIAAHLGRIPLGHIARLGTGRISKVMDESVGG
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------YCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQ
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IEQFIGHSIPDXXXXXXXXXXXXXXXFVFDWRFGXXXXXXXXXXXXXQFSGYADKRVMASMGRYQEVKEQ
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3b60A           VASXXXXXXXXXXXXXXXXXXXXXXXFYYSXXXXXXXXXXXXXXXXXXXXXX--KRFRSISKNMQNTMGQ
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           -------------------------------------------------------------ARIESKTVI
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ------------------------------------------------------------VARIESKTVI
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ---------------------------------------------------TDPRDVARIESKTVIITQE
2c04A           ----------------------------------------------------------------------
1accA           ---------------------------------------------------------------------K
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ------------------------------------------------------------VARIESKTVI
1cr4A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ------------------------------------------------------------VARIESKTVI
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           --------------------------------------------------------------FIAENQNE
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           --------------------------------------------------------------FIAENQNE
3cphA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MGNASVEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAYLFVLPVGIL
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3b60A           VTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISXXXXXXXXXXXXXXXXXXXXX
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSP
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTLGSPLAKIGIELTDSPYVVASMRIMT
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----QRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFGRTMYVIPFSMGPLPLAKIGIELTDSPYVVASMR
2c04A           ----------------------------------------------------------------------
1accA           NETISKNTSTSRTHTSEVVSAGFSNSNSSTVAIDHSLSLAGGLNTADTARLNANIRYVNTGTAPIYNVLP
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSP
1cr4A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTSMGPLGSPLAKIGIELTDSPYVVASM
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           LLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSVK-DENAAESQISELALRAVQIGLSKFLATA
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           LLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSVKD-ENAAESQISELALRAVQIGLSKFLATA
3cphA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LAPGAQDWPTXXXXXXXXXXXXHSISSVFTKILYVSEDGMLAQANIDRIDSVLGIEELSCPEAPKAPKDA
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvG           --------------------------------------------------AALGQIEKQFGKGSIMRLGE
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3cmvC           ------------------------------------------------------------------MRLG
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3czpB           -------------------------------------------------------------------DTY
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           ---------------------------------------------------------------------G
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------SAEVGH
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           ---------------------------------------------------------------------G
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cmvB           ---------------------------------------------------------------GSIMRLG
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           --------------------------------------------------------------SQQQTVRG
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ------------------------LSSKYSRNTELRRVEDNDIYRLAKLDENSCWRKLMSIIPKGMDVQA
3d31A           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ---------------------------------------------------------------------A
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           --------------------------------------------------------------------VS
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2c9gA           ------------------------------------------------------------FMFTNKFKAR
1d8jA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ---------------------------------------------------------------EGDTLVN
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           --------------------------------------------------NSVGQGEFG-GAPFKRFLVS
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           -----------------------------------------------KTQRIASHSHVK-GLGLDESGLA
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           -------------------------------------------------------------------ELT
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           -----------------------------------------------KTQRIASHSHVK-GLGLDESGLA
3dmdA           ---------------------------------------------REKIKQKLVGKKVR-IGTDKGKIIE
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dhrF           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3b60A           XXXXXXXXXXXXXXXXXXXXXXXXLTNVNAQF----QRGMAACQTLFAI---LDSEQEKDEGKRVIRATG
2d3wB           ----------------------------------------------------------------------
2dwoA           -------------------------------------------------------------------ELT
3eiuA           -----------------------------------------SVDLLGRILSGSGEPRIVPDQLLDINGAA
2c61B           ---------------------------------------------SGEPRDGGPRIVPDQLLDINGAAMN
3dmdC           ---------------------------------------------VDALREKIKQKLVG-KKVRIGTDKG
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1dkiA           -----------------------------------------SFDVNGKENIASFMEEQIKENKKLPVVKS
3eiuB           -----------------------------------------------------------QLLDINGAAMN
3dtbB           YVVASMRI---MTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHSFGSGYGGNS
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           -----------------------------------------ADVNLEVTRDFVEREEALGKQVLESLTPA
1e9fA           ----------------------------------------------------------------------
2c03A           -----------------------------------------ADVNLEVTRDFVEREEALGKQVLESLTPA
3dmdB           ---------------------------------------------VDALREKIKQKLVGKKVRDKGKIIE
3dm5A           -----------------------------------------ADVNVRLVLQLTREIRRALEEKPPAGISK
3c95A           -----------------------------------------------------------WRGNTSWVAPL
2ccgB           ----------------------------------------------------------------------
4dcgA           -------------------------------------------VSLDKPFMYF--EEID-NELDYEP---
3dt2A           RMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGGNSLLGKKCF
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           --------------------------------------------------------------------RG
3dt4C           IMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPEIAHLPDRREIIGSGYGGNSLLGKKCF
2c04A           -----------------------------------------ADVNLEVARDFVEREEALGKQVLESLTPA
1accA           TTSLVLGKNQTLATIKAKENQLSQILAPNNYYPLNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYG
1bifA           ----------------------------------------------------------------------
3b2qA           -----------------------------------------------------------PDQLLDINGAA
2dr3A           ----------------------------------------------------------------------
2b8wA           -------------------------------------------------------------------TGP
2bbsA           ----------------------------------------------------------------------
2c61A           -----------------------------------------SVDLLGRILSGSGEPRDGPDQLLDINGAA
2dr3E           ----------------------------------------------------------------------
1e9sG           --------------------------------------------------NSVGQGEFGGAPFKRTRIVS
2awnD           ---------------------------------------------------------------------A
2czvA           ----------------------------------------------------------------------
1e1qB           -------------------------------------------ELLGRVVDALGKGPIGSKARRRVGLKA
2cgtH           ----------------------------------------VKFGNDARVKMLRGVNVLAVTLGPKGRNVV
2bifA           ----------------------------------------------------------------------
3dt4A           YMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGGNSLLGKKCF
1cr4A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           -----------------------------------------FNDAQYKAFIEPIKQGQACTVDIGGERVI
1aroP           ----------------------------------------------------------------------
1e9sF           --------------------------------------------------NSVGQGEFGGAPFKRTRIVS
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ---------------------------------------------------------------------G
2d62A           ---------------------------------------------------------------------A
2c9oC           -------------------------------------------TKTQRIASHSHVKG----LGLDESGLA
3bb1H           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           -----------------------------------------------------------------TRIVS
3bb1F           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           --------------------------------------------------------------------GP
2a2zA           ----------------------------------------------------------------------
2d4hB           --------------------------------------------------------------------GP
3da4A           -----------------------------------------LEDYIKKHGASNPLTLSTNIGYFCNADRN
2eg5G           ------------------------------------------------------------------AKNS
3cr7C           ----------------------------------------------------------------------
3di4A           ------------------------------------------------------------DSLPRPDLAL
1e6cA           ----------------------------------------------------------------------
1e9sD           -----------------------------------------------------------------TRIVS
3ec1A           ----------------------------------------------------------------------
3bb1E           ---------------------------------------------------------------------G
2b92B           -------------------------------------------------------------------TGP
2dr3B           ----------------------------------------------------------------------
3dt7A           RIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNPELTLIAHLPDRREIISFGSGGNSLLGKKCF
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           --------------------------------------------------------------SEIHMTGP
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ------------------------------------------------------DGSID-EALVTVYEEI
2akaA           ----------------------------------------------------------------------
2bkhA           ---------------------------------------------------------------SETIKSY
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ---------------------------------------------------------------SLRERIR
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ------------------------------------------------------------PDGVVSALSL
2dr3F           ----------------------------------------------------------------------
1bg0A           ---------------------------------------------------------------------K
3ed8A           --------------------------------------AMPEGYVQERTISFKDDGKYKTRAVVKFEGDT
2bbtB           ------------------------------------------------------------------EEGF
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           -------------------------------------------------------------------KTN
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ---------------------------------------------REKIKQKLVGKKV--RIGTDKGKII
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           -------------------------------------------------------------------REH
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ---------------------------------------------LGNAIDGKGPIGSKARRRVGLKAPG
2bdtA           ----------------------------------------------------------------------
2ck3C           -----------------------------------------GEELLGRVVDALGNDGKGPIGSKARGLKA
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           -------------------------------------------------------------------REH
3cr7A           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           --------------------------------------------------------------------GP
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ---------------------------------------------------------------------S
2dr3D           ----------------------------------------------------------------------
1e9sJ           --------------------------------------------------------------------VS
1e9sB           --------------------------------------------------NSVGQGEFG-GAPFKTRIVS
3bgwD           ----------------------------------------------------------------------
2b8wB           --------------------------------------------------------------------GP
2d2eA           ---------------------------------------------------------------------S
2bkiA           -------------------------------------------------------FDIPKIYSSETIKSY
3d3qB           ----------------------------------------------------------------------
3d3kA           -----------------------------------------------------------VP-SKEFCTDS
3cddC           ----------------------------------------------------------------------
2d2fA           ---------------------------------------------------------------------S
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
1ckvA           ------------------------------------------------------------------SVNS
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bkeA           -----------------------GISQTVINKLILETLAVASPQDLSVAAGIPLSTQKIIKEARDALDIR
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           --------------------------------------------------------------------VS
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ------------------------------------------------------------------RIVS
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           --------------------------------------------------NSVGQGEFGGAPLRGTRIVS
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ------------------------------------------------------------LDIRFKTALE
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ---------------------------------------------------LLNKVDIADEKTTKKWVEF
1e9rF           --------------------------------------------------------------------VS
1e9rD           ------------------------------------------------------------------RIVS
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           --------------------------------------------------------------------VS
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ------------------------------------------------------------DKEERGNKGA
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           --------------------------------------------------NSVGQGEFG-GAPFKRFLVS
1drbA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------NDISGTERQDVETTLCPNANSRVSKNINFDSRYPTL
1e4vA           ----------------------------------------------------------------------
3dfdA           ---------------------------------------------------------------SFFPGQ-
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------PLPADKQ-----
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ---------------------------------------------------------------------A
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           -----------------------------------------SDFGPKITVRIVERLREDIMSGKLKSGSE
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ------------------------------------------------------------EANVDPEEAF
3dm5B           -----------------------------------------ADVNVRLVLQLTREIRRALEEKPPAGISK
2e85B           ----------------------------------------------------------------------
2d7vB           -------------------------------------------------------VPLSVEANVDPEEAF
1c9kC           ----------------------------------------------------------------------
1av6A           -------------------------------------------------------------EEIDNELDY
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ---------------------------------------------------------------QLELKDD
2ancF           ----------------------------------------------------------------------
3cqcA           ------------------------------------------------------------VFDPAQRAEA
3cqcA           ----------------------------------------------------------------------
3brwA           -------------------------------------------------------------------TKV
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           --------------------------------------------------------------------VS
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           L---------------------------------------------------------------------
1e9sK           ---------------------------------------------------------------------S
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           L---------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3e70C           ---------------------------------------------REKIKQKLVGKKVRIGGKII-EEAV
1delB           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREM
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvG           -DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHA-L
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3cmvC           EDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3cmvA           ---VETISTGS-----LSLDLGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3czpB           EKAVIELREALLE----AQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEEL
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnB           ----------------------------GNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERC
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           -SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           WSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3czpA           SIDKDTYEKAVIELREAAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEEL
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           WSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2awoC           ------------------------------------QIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERC
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cmvB           EDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI--DAEHA
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           WSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cmvE           ---VETISTGS-----LSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           FPAEIKKGFKYTAQDVFQIDEAANRLPPDQSKSKTSGKLNERPTVGVLLQLLVQASAADFVALDFLNEST
3d31A           ------------------------WVLGALVRVKVDCGVPLNVLITRRSAEEMELSPGVQIYARFKA---
2drcA           ----------------------------------------------------------------------
2awoA           -------------------------------TQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERC
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           SVQLQNVTKAWGE--VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3cmtD           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAF--IDAEHA
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3cmuA           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2c9gA           VMVSRSLTKDKQVE--LKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESDIG-------
1d8jA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           RIELKGIDFKEDGNILGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPIGD
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1e9rB           GGKLKRMTREKAKQV--TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           KQAASGLVGQENEACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKV-------------
3c7kA           --------------------------------LLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTI
1e2kB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGEPMTYWRVLGASETIAN
1e2nA           ----------------------------------------------------------------------
2bwjD           -------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----------
2a5vB           ------------DSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---RDVVERV
2bwjB           ----------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS-------TGEL
2a5vA           ------------DSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---RDVVERV
3b85B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           QSRVQKIWVPVDH---RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYL-----------------
2c5mD           ----------------------------------------------------------------------
2cbzA           SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGK----------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           -VVMENVTAFWEEGLGPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGEL-----------------
3c7kC           ----------------------------------------------------------------------
1e2jB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
3c94A           ----------------------------------------------------------------------
1e2mA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMVLGASETIAN
1e2lB           ----------------------------------------------------------------------
2c9oB           KQAASGLVGQENEACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
3dmdA           EAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGK----------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           ------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHL-------STGEL
2ax4A           ----------------------------------------------------------------------
1dw9A           -----------------ADAILLSKAKKDSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLD
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1delA           ------------------------------LIFLSGVKRSGKDTTADFIMSNY---SAVKYQLAGPIK--
3cddA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           ------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHL-------STGEL
2c95B           -----------------------EKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGLSTGDLLRSEVSSGS-
3co5B           ----------------------------------------------------------------------
2a78A           -------------------------------VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKV
2bwjE           -------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----------
3dvlD           ----------------------------------------------------------------------
1dapA           ------------------FDSEHTGMPHGGHVITTGDTGGFNHTVE------------------------
3cddE           ----------------------------------------------------------------------
3cbqA           -------------------------------VMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERR
1chdA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1akyA           ----------------------------SIRMVLIGPPGAGKGTQAPNLQERFHA---------------
3dsrB           ----------------------------------------------------------------------
2dhrF           -------------------HEMGARIPKGVL--LVGPPGVGKTHLARAVAGEARVP--FITASGSDFVEM
3b5jA           -ITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3b60A           DLEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
2d3wB           -LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
2dwoA           QSRVQKIWVPVDH---RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
3eiuA           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAMGI
2c61B           PYARLPPKDFIQT--GISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
3dmdC           EAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
2akaB           ---MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQ
1e69A           -----------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
2dwpA           ---------------QSRVQKIWVPVDHRTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
1dkiA           LLDSKGIHYNQGNPYNLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNN
3eiuB           PYARLPPKDFIQTG--ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
3dtbB           LLGKKCFALRIASAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2b8tA           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTR
1e9cA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
1d1cA           ------VAPHIFAIS-DVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQIL
2cjwB           ------------------------GMTYYRV-VLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATII
2c03B           EVILATVYEALKEA--LGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
1e9fA           ----------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERST
2c03A           EVILATVYEALKEA--LGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
3dmdB           EAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
3dm5A           KEHIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRP
3c95A           AWHPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDN
2ccgB           ----------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
4dcgA           -ESANEVAKKLPYQGQLKLLLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
3dt2A           ALRIASRLAKEEGWLAMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2c9yA           ----------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVAS
1e2dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2ccjB           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
1e98A           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
3b2qB           ---RLPPKDFIQTG--ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2ccgA           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3bb1A           WSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3dt4C           ALRIASRLAKEEGWLAMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2c04A           EVILATVYEALKEA--LGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
1accA           NIATYNFENGRVRVDTGIIFNGKDLNLVERRIAAVNPSTTKPDMALKIAFGFNE-PNGNLQYQGKDI---
1bifA           ----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
3b2qA           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2dr3A           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2b8wA           MCLIENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
2bbsA           -VVMENVTAFWEEGFGPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2c61A           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2dr3E           -------TRRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
1e9sG           GGKLKRMTREKAKQ--VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2awnD           SVQLQNVTKAWGE--VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2czvA           ----------------GGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAIL
1e1qB           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
2cgtH           LDKSFGAPTITKDGVS-VAREIELEDFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAA
2bifA           ----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
3dt4A           ALRIASRLAKEEGWEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
1cr4A           -SSEESVGLLFSG--CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
3b85A           ----------------LGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA
1e9dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2ahvA           ---VKPPRINGRVP-VLSAQEAVNYIPDEATLCVLGAILEATTLITALADKYISPTGLGDRADRGISPLA
2c4rL           --------VLMPNNPRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIK
2a2zD           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
3cddF           TGYVDDWVPSYDESTIISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPF
1aroP           ----------------------------------------------------------------------
1e9sF           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3d7wA           ---VSSGSFSNN---IPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSD
2bofX           -------------------------------------------------SPFYNPNMSSAEWVRNNPNDP
1e3mB           --------------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRI
1e2fA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2ctsA           ---------ASSTNLKDILADLIPKARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEG
2a5gA           -------------------------------ILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY
2awnC           -------SVQLQN--VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVFQ-----------
3bb1B           WSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVS
2d62A           EVKLINIWKRFGD--VTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYDNLVADPEKG
2c9oC           KQAASGLVGQENEACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
3bb1H           ----------------------------------------------------------------------
2cckA           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
2axpA           -----------------------------TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGN
2bbsB           --TTEVVMENVTA--FWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2axzC           ----------------------------------------------------------------------
1e9rA           GGKLKRMTREKAKQ--VTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3bb1F           ----------------------------------------------------------------------
3a1wA           --------------------------------ALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGV
1e4yA           -------------------------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
2ahwD           ---VKPPRINGRVP-VLSAQEAVNYIPDEATLCVLGAGLEATTLITALADKYISPTGLGDRADRGISPLA
1dg3A           MCLIENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPG
2a2zA           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
2d4hB           MCLIENTNGRLMANALKILSAITQPMVVVAIV---GLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGL
3da4A           LVLHPGISVYDAYH-----FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLK
2eg5G           AYNQLVLAKVKEQCVRELLRANLPNINKCIKVADLGCASGPNTLIVQSIDKVGQLERPTIQIFLNDLFPN
3cr7C           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3di4A           YRAARASARKTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGD-----LNLHNLHDLTERFFSGKTRAL
1e6cA           ------------------------------PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGM
1e9sD           GGKLKRMTREKAKQ--VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3ec1A           ----------------AKVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTL
3bb1E           WSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
2b92B           MCLIENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
2dr3B           -------TRRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
3dt7A           ALRIASRLAKEEGWLAMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
3bb1C           ----------------------------------------------------------------------
2b8tB           ----------------------------GWIEFITGPMFAGKTAELIRRLRLEYADVKYLVFKPKILPSV
3bm2B           ----------------------------------------------------------------------
2bc9A           MCLIENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
2a30A           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
421pA           -------------------------------LVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV
1e3mA           ---VLTSKGKALALEKQLYEELFDLLLPHLEALQQSASLVNLAERAYTLNYTCPTFIDKPGIRITEGRHP
3cddD           -----EIVLKA--GGKIYQGWTKIGITRS-----LEASGAFDLETY----KFNDAQYKAFIEPIKQGQAC
3bh0A           ESADGNITGVPSG--FTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
2akaA           ----RNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQ
2bkhA           QGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA
3bpbA           -IIARTPARSLVDLTSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERSVFVEDPVLCTSRCAIITRP
1dhjA           ----------------------------------------------------------------------
3bgwA           --------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
1e0jA           EHLSSSVGLLFSG--CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2d0kA           ----------------------------------------------------------------------
3cr7D           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD--N
1e0jB           RSSEESVGLLFSGC--TGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2dr3F           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
1bg0A           KHLTKDVFDSIKNKKTGLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHPPKQ
3ed8A           RIELKGTDFKED---GNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNT
2bbtB           GELFEKAKQNNNN--TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2d3wC           -LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
1e3aB           ------AKNWQEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPF
3c8uA           -------TLAALC--QGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEV--VPDGFH
2dr3C           -------TRRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2a5jA           ------------------SSGLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDG
1e2gA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
3bo6B           FHSLHNQMRQM--PMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDK
2a30B           ----------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVL
2d3wD           -LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
3dm9B           EEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
3cbnA           --------------------------------------------------------RYTLRARGHPNV--
3bb1D           -SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3bb1D           ----------------------------------------------------------------------
1e59A           ------------------VTKLVL-VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFD
3cmxA           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3cmxA           ----------------------------------------------------------------------
1cr1A           LSSEESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKK-VGLAMLEES
1cr0A           --SEESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
3bczC           ------------------VCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGS
3dhwC           -IKLSNITKVFHQGTRQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
3d3qA           ----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
3ecpA           ----------------------------------------------------------------------
1bmfC           IIPRISVREPMQT--GIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
2bdtA           ------------------------------LYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGG
2ck3C           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
2a2zB           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
2cckB           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3dffA           ---------------------------------------------------------DAVLSFGAGLAQA
1dvrA           ----------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAK
2b8tC           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSR
1cr2A           LSSEESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
3cr7A           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3bb1G           ----------------------------------------------------------------------
1ai4B           ----------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPF
1ak2A           --------------------------PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVAS
2d4hA           MCLIENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWC
3bjdB           ----------------------------------------------------------------------
2cvfA           ------------------DSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPE-
1e9rG           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2dr3D           -------TRRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
1e9sJ           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e9sB           GGKLKRMTREKAKQ--VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3bgwD           --------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
2b8wB           MCLIENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
2d2eA           QLEIRDLWASIDG--ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENIL
2bkiA           QGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA
3d3qB           ----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
3d3kA           GLVVPSIS--YELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTLLCGPHVKGAQGISCG
3cddC           --------------------------------KAGGKIYQGWTKIGITRSLETYKFQYKAFIEPIKQGQA
2d2fA           QLEIRDLWASIDG--ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENIL
2bhvD           ---------------------------------------------------------------LRTITAD
3ch4B           --------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQ
1bglA           ----------------------------------------------------------------------
3adkA           ----------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSS
2bx2L           ----------------------------------------------------------------------
3a00A           --------------------------------VISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1dhiA           ----------------------------------------------------------------------
2d3wA           -LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTKDLLALSPEDRA
1d2zD           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
1ckvA           NAYDAGIMGLKKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNANGKIEV
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bkeA           FKKERNVKKISTG--SQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKG----------
1e2iA           -------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYT
1d6jA           ----------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3cm0A           ----------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVAR
1e9sE           GGKLKRMTREKAKQ--VTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2d4uA           ---------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWV
1culC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1e9rE           GGKLKRMTREKAKQ--VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3c85A           --------------------------------------------------QLINPGHAQVLILGGRIGTG
1d6jB           ----------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLDGDNIRFG
1e9sL           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3cioD           -------------------HFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRG
2a1fF           ----------------------------------------------------------------------
2dflA           VKKERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYID
3cr7B           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
1afrA           ----------------EVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGF
1afrA           ----------------------------------------------------------------------
1b0uA           -LHVIDLHKRYGG--HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV
3clvA           -----------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYV
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGAS
3cnlA           FKKQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSL--------
1e9rF           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e9rD           GGKLKRMTREKAKQ--VTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3be4A           -------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKN
3a00B           ------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1ek0A           -------------------------------LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQR
1e2hB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
3cmwC           ----------------LSLDIALGALPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2bhvA           ---------------------------------------------------------------LRTITAD
1e9sM           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2c7cH           ----------------------------------------------------------------------
2bhjA           --------------------------------------------------RIKNWGSGEILHDTLHHKAL
1cjtC           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           -----------------------VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSD-------------S
2c0bL           ALTTFISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLKHWEAI
1cs4C           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           -------PIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1drbA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2b8tD           ----------------------------GWIEFITGPMFAGKTAELIRRLHRL-----------------
2dftC           ------------------------------KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGR
2a1fE           ----------------------------------------------------------------------
2bwjA           ---------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS-------TGEL
1dyhA           ----------------------------------------------------------------------
1akeA           --------------------------------ILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
3dymA           ----------------------------------------------------------------------
2bbtA           -VVMENVTAFWEEGFGPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
1d6aA           VKSRSQVQLGIQDSNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIEN-QVKTNFNRAFNPNPKVL
1e4vA           --------------------------------ILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
3dfdA           TIDAEEVEVPISKRFVKEGNVVPFIFKAITRIDELEKENTTKEL-------DSQRFYARIAVETTVYPTF
1dekA           ------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAY
2czvB           ------VKFI--EMDIRDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRD
3czjA           ----------------------------------------------------------------------
2bv7A           -IETGPFLEAVSHLPPFCLGSPVFTPIKAKIKAVYDTNPTKFRTLQNILEVEKEMYGAEW-------PKV
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1azsC           -------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           SVQLQNVTKAWGE--VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------
1cjaA           ----------------------------------------------------------------------
2bjbA           ---LQTLGLRVDGVGSLTVSGRIEPGPGARV--DCGLAG----TVLRFVPPLAALGSVPVTFDGDQARGR
1cfrA           --------------------------------DIISKSGEGNKYTINSAIAFIDINTTEFSKVLSGLRDF
3crmA           ----------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMD
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------APVITIDGPSGAGKGTLCKAMAEALQLDSGAIYRHHVDVSED
2dpyA           -------PIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
2c9gA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAY
3b9qA           IKDALKESVLEML--AKSKTELQLGFRKPAVIMIVGVNGGGK----------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETI
3c15C           -------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
2d7vA           VAALSSCHLVF--LSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH
3dm5B           KEHIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRP
2e85B           ----------------------------------------------------------------------
2d7vB           VAALSSCHLVF--LSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH
1c9kC           ------------------------------MILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDG
1av6A           EPESANEVAKK-LPYQGQLKLLKLQRHGILDGATVVYIGSAPGTHIRYLRDHF-----------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
2e85A           ----------------------------------------------------------------------
3cueF           ------------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDG
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2ancD           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYD-------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ILYPYGHYIAKID--HRFLKSLENHEDGKVTAVTPTPAGEGKTTTSIGLSSLNRIGKKSIVTLREPS---
2ancF           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIE-------
3cqcA           LKQGNAIMRKFLASKKEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYL----------------
3cqcA           ----------------------------------------------------------------------
3brwA           KLECNPTARIYRKLGKEHFNYYSLDTALGHLVFSLKYDVIGDQE--------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----PAKKLPYQGQLKLLLGELKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
1e2jA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMVLGASETIAN
3bwdD           ----------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGE
3c14C           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
4atjA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2anbA           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPR
2a1fC           ----------------------------------------------------------------------
1e9sA           GGKLKRMTREKAKQ--VTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3e8aC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e2hA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASE
2ax4B           ----------------------------GCTVWLTGLSGAGKTTISFALEELVSHAIPCYSLDGDNVRHS
1dp0A           ----------------------------------------------------------------------
1e2nB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
1e2mB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY----------
1cjvC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNL---
2ancB           ----------------------------------------------------------------------
2ancB           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQ-----------------
2bhvC           ---------------------------------------------------------------LRTITAD
1cjuC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN--N
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2nA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMT----
2bwjD           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           GGKLKRMTREKAKQV--TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM----------
2cdnA           ---------------------------SHMRVLLLGPPGAGKGTQAVKLAEKLGIPGELFRRNIEEGTKL
2bboA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2lB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRD--DIVYVPEPMTYW
2c9oB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           --------------------------------VLMGLPGAGKGTQAERIVEKY--GIPHISTGDMFRAAM
2bwjF           ----------------------------------------------------------------------
2ax4A           ----------------------------GCTVWLTGLSGAGKTTISFALEYLVSHAIPCYSLDGDNVRHG
1dw9A           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           -------------------------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQ
2bnlA           ----------------------------------------------------------------------
3cphA           -------------------------------ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGI------
1delA           ----------------------------------------------------------------------
3e70C           KEAVSEILETSRR---IDLIEEIRKAEKPYVIMFVGFNGSGK----------------------------
1delB           --------------------------------FLSGVKRSGKDTTADFIMSNYSA---VKYQLAGPIKDA
2bwjC           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHL
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvG           DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSV------AALTPKAEIEGLAARMM
3dmdC           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3cmvH           PIYARK--LGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVD-----------SVAALTPLAARMM
1dkiA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3cmvC           PIYA-RKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVI------------VVDSVAALTPLAARMM
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3cmvA           PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVD--------------------VIVVDSVAALT
3dmdB           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3czpB           ERPPQWRFWRRLPPKGRTG---------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnB           HLREDGTACRRLHKEPGVASAS------------------------------------------------
3b85A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
3bb1H           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKS--FLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDS
2cckA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1F           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDLDKLVAKAITDSFGK
3a1wA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3czpA           ERPPRFWRRLPPKGRTGIFFGNWYSQLYARVE--------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3bb1C           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDLDKLVAKAITDSFGK
2b8tB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2awoC           HLREDGTACRRLHKEPGVASAS------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3cmvB           LDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIGLAA-------RM
3cbnA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3bb1G           SRSRAGFTLNIIDTPGLIEGGYINDMALNIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGK
1ai4B           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cmvE           PIYA-RKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEISHMGLAARMM
3adkA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1d2zD           PVDGPGALISLELLE-------------------------------------------------------
3d31A           -------------SSVHVLR--------------------------------------------------
2drcA           ----------------------------------------------------------------------
2awoA           HLREDGTACRRLHKE-------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bk7A           -------------------------------------------------------------VLDRELHQL
2c7cH           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
1cjtC           AIEAAMSNLVPPVELANPENQFRVDYILSVMN--------------------------------------
5dfrA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1cs4C           AIETIVAAMSNLVPPVELANPENQFRVD------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2awnA           PPAERG----------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3cmtD           LDPIYARKLGVDIDNLLCSQP-------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3e0cA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e9sI           SKFGRDKDIILNPYDQRTKGWSFFNEIR------------------------------------------
1azsC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3cmuA           PIYARKL--GVDIDNLLCQPDTGEQAL-------------------------------------------
2c9gA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3cd9A           GPVLLPDNHYLSTCS--ALSKDPNEKR-------------------------------------------
2anbA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9rB           SKFGRDKDIILNPYDQRTKGWSFFNEIR------------------------------------------
1e2hA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3c7kA           QSLAAI----------------------------------------------------------------
1e2kB           IYTTQHRLDQGEISAGDAAVVMTSAQITMGMP--------------------------------------
1e2nA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2a5vB           APSVLL-----GRRDGLSRDEFEQRHVHET----------------------------------------
2bwjB           LREEL-----------------------------------------------------------------
2a5vA           APSVLL-----GRRDGLSRDEFEQRHVHET----------------------------------------
3b85B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
1e2jB           LGASETIANIYTTQHRLDQGESAGDAAVVMTS--------------------------------------
3c94A           ----------------------------------------------------------------------
1e2mA           IYTTQHRLDQGEISAGDAAVVMTSAQITMGMP--------------------------------------
1e2lB           ----------------------------------------------------------------------
2c9oB           EIKKTE----------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2bwjF           LREEL-----------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
1dw9A           EDSIL-----------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1d0sA           ----------------------------------------------------------------------
1delA           --DALAYAWGVFAANTDYPCLTRFEGIDYDRET-------------------------------------
3cddA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2bwjC           LREELASERSKLIRDIMERGDLVPSGIVLE----------------------------------------
2c95B           -------ARGKKLSEIMEKGQLVPLETVL-----------------------------------------
3co5B           ----------------------------------------------------------------------
2a78A           VLD-------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
3cbqA           IMVD------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1akyA           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dhrF           FVGVGAARVRDLFE--------------------------------------------------------
3b5jA           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGL
3b60A           TLASLRNQVALVSQNVHLFNDTVANNIAARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLL
2d3wB           ALSPEDRGIFMAFQYPVEIQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGF
2dwoA           EAVKQYSSYNFFRPDNEEAMKVRKQCALA--------------------ALRDVKSYLAKEGGQIAVFDA
3eiuA           TNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVTDLATLYERAGIV
2c61B           ITNEEAYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGYMYTDLATLYERAGIV
3dmdC           GAIEQLEEHAKRIGVKVIKHSYGADPAAVAYD---------------------AIQHAKARGIDVVLIDT
2akaB           LVNSTTEYAEFLHCKGKKFTDFEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQP
1e69A           GSAYVELVFEENGEEITVARELKRTRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLL
2dwpA           EAVKQYSSYNFFRPDNEEAMKVRKQCALAA--------------------LRDVKSYLAKEGGQIAVFDA
1dkiA           PYF---------NHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSA
3eiuB           ITNEEAYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGYMYTDLATLYERAGIV
3dtbB           AQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPG--VTITSW
2b8tA           SIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRINGFVVIISGLDKNFKGEP
1e9cA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQV-------PLIKEKLSQGVTLVVDRYAFSGVAYTGAKE
1d1cA           QANPILEAFGNAKTTRNNNSSRFGKFIEIQFN--NAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQL
2cjwB           LLDMWENHDHMQVGDAYLIVYSITDRASFEKA----SELRIQLRRARQTEDIPIILVGNKSDLVRREVSV
2c03B           AAREQLRLLGEKVGVPVLEVMDGESPESI---------------------RRRVEEKARLEARDLILVDT
1e9fA           EIGKLLSSY--LQKKSDVEDHSVHLLFSANRW-----EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKE
2c03A           AAREQLRLLGEKVGVPVLEVMDGESPESI---------------------RRRVEEKARLEARDLILVDT
3dmdB           GAIEQLEEHAKRIGVKVIKHSYGADPAAVAYD----------AIQHAKARGIDVVLI-----------DT
3dm5A           GAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKE--------------GVDYFKSKGVDIIIVDTAGRHKED
3c95A           LKILRREKVVAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVKLLFNYRARNFPGTL
2ccgB           GEEIRKIVLEGNDMDIRTEAMLFAASRREHLV------------LKVIPALKEGKVVLCDRYIDSSLAYQ
4dcgA           DPILNVTRFVDEEYLRSIKKQLHPSKIILISDVLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDFYI
3dt2A           AQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITS--W
2c9yA           GSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVI
1e2dA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQ-------VPLIKEKLSQGVTLVVDRYAFSGVAFTGAKE
2ccjB           GEEIRKIVLEGNDMDIRTEAMLFAASRREHLV-----LKVIPALKEGKVVLCDRYIDSSLAYQGYARGIG
1e98A           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQ-------VPLIKEKLSQGVTLVVDRYAFSGVAFTGAKE
3b2qB           ITNEEAQYFMSDFEKTGALERVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVTDLATLYERAGIV
2ccgA           GEEIRK-IVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLA-----------YQ
3bb1A           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIK--SFLLDKTIDVLLYVDRLDAYRVDNLDKLVATDSFGK
3dt4C           AQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAP--GVTITSW
2c04A           AAREQLRLLGEKVGVPVLEVMDGESPESI---------------------RRRVEEKARLEARDLILVDT
1accA           ------------TEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAV
1bifA           DMVKTYKSFEFFLPDNEEGLKIRKQCALA--------------------ALNDVRKFLSEEGGHVAVFDA
3b2qA           ITNEEAQYFMSDFEKTGAERAVVFLNLADDPA----VERIVTPRMALTAAEYLAYEHGMHVLVILTDITN
2dr3A           QVRQNMAQFGWDVKPYEEKGMFAMVDAFT-------------------------AGIGKEYEKYIVHDLT
2b8wA           MWCPKKPGHILVLLDTEGLGDVEKGDNQNDSWISTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFF
2bbsA           QNSWIMPGTIKENIIGVSYDEYRYRSVIKAC-------------------QLEEDISKFAEKDNIVLITL
2c61A           ITNEEAQYFMSDFEKTGALERAVVFLNLADDP---AVERIVTPRMALTAAEYLAYEHGMHVLVILTDITN
2dr3E           QVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGI-------------------------GKEYEKYIVHDLT
1e9sG           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDY--DWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKGT
2awnD           PPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH---DQVEAMTLADKIVVL
2czvA           LSNPKPSLVRVESNDLRVIRYSIEKGVDSPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERA
1e1qB           VAIGQKRSTVAQLVKRTDADAMKYTIVVSATASMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPP
2cgtH           GMNPMDLKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRG----YL
2bifA           DMVKTYKSFEFFLPDNEEGLKIRKQCALA--------------------ALNDVRKFLSEEGGHVAVFDA
3dt4A           AQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWE--GIDEPLAPGVTITSW
1cr4A           EETAEDLIGLHNRVRLRQSDSLKREIIENGKF----------------DQWFDELFGNDTFHLYDSFAEA
3b85A           GEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEPAQKFLTRLGFGS
1e9dA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQV-------PLIKEKLSQGVTLVVDRYAFSGVAYTGAKE
2ahvA           QEGLVKWALCGHWGQSPRISDLAEQNKIIAYN-YPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGG
2c4rL           KAAESRPAPFLIHQESNVIVRAFRDYLRQDIG-EILIDNPKVLELARQHIAALGRP-DFSSKIKLYTGEI
2a2zD           STNVLPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWT----IY
3cddF           QRIQIEQGETPHKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQR----FSKFTIK
1aroP           ---------------------NDFSDIELAAIPFNTLADHYGERLAREQL---ALEHESYEMGEAR---F
1e9sF           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYD------------------WQRYALSVVPR-------GK
3d7wA           APAGAETQDFSGTTSSSQPFNGSYPDLERYA------------------GHRDQIPLGIDQL-IQSVTAL
2bofX           RTPVIRDRIASVPQGT------WFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRD----CGAPS
1e3mB           -TEGRHPVVEQVLNEPFIANLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTR
1e2fA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQG-------VTLVVDRYAFSGVAFTGAKE
2ctsA           IRFRSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNL
2a5gA           KNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVADRDRIDEARQELHRIINDREMRDAIILIFANKQDLP
2awnC           -------------SYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL-----QLAHLLDRKPKAL
3bb1B           RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGK
2d62A           VFVPPKERDVAVFQSYALYPHTVYDNIAFPLK------LRKVPKQEIDKRVREVAELGLTELLNRKPREL
2c9oC           EIKKTEVLMENFRRAIGLRIKETKKKE-IIQDVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVH
3bb1H           ----------------------------------------------------------------------
2cckA           GEEIRKIVLEDMDIRTEAMLFAASRREHLVL------------------KVIPALKEGKVVLCDRYIDSS
2axpA           EKLFELADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHVIKKRLRVRGDEYI
2bbsB           QNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEE---------------DISKFAEKDN--IVLGGITL
2axzC           --------------------------------------------------FFGIDYEIVSNLLNVLPYEE
1e9rA           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL------LRETA
3bb1F           ----------------------------------------------------------------------
3a1wA           FTYKGYTINLIDLPGTYSLGYSSIDEKIARDY-LLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVIL
1e4yA           GSELGKQAKDIMDAGKLVTDELVIA-------------------------LVKERIAQEDCRNGFLLDGF
2ausC           --------------------EVIVKDDKAETNPKWGFPPDKRPIELHIQYGVINLPPGP----------T
2a30D           STNVLQMMYEFTFQTYACLRIRAQLASLNGKPFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWM
2ahwD           QEGLVKWALCGHWGQSPRISDLAEQN-KIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGG
1dg3A           HILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRRSKSDSADF
2a2zA           STNVLQMMYEKPERWSFTFQTYACLSRIRAQ----LASLNGKEKPVLFFERSVYSDRYIFASNLYE---S
2d4hB           GQIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEA
3da4A           ISPMKINQIKTFPVSTKFTHATGDYNVITGA---------------------------------------
2eg5G           DNSVFKLLPSFYRKLEKENGRKIGSCLISFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSI
3cr7C           FGLNKDL--GFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTRDPKGLYKKAR
3di4A           HGTHVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYYHHCCHSNLTRALADHTGL
1e6cA           TVADVEGWPGFRRRESEALQATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELLQASLQAHQRP
1e9sD           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDY-------------------------DWQRYALSVVPRGK
3ec1A           DMIEIPLESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRV---YQLNEGQTLFFGGLARL-DY
3bb1E           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLKLVAKAITDSFGK
2b92B           MWCPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTSSF
2dr3B           QVRQNMAQFGWDVKPYEEKGMF----------------------------AMVDAFTAGIGEKYIVHDLT
3dt7A           AQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPG--VTITSW
3bb1C           ----------------------------------------------------------------------
2b8tB           EVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG-------EP
3bm2B           ------------ALELLINRRSASRLAEPAPT-GEQLQNILRAGRAPDWHFFVIEGEGRERFSAEQGAIA
2bc9A           MWCVPHPKKPGHILVLLDTEGLGDVEKGDNQN------------------DSWIFALAVLLSSTFVYNSI
2a30A           STNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECY
421pA           VIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNK
1e3mA           VVE-QVLNEPFIANPLNLSPQRRLIITGPNGG----KSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFT
3cddD           -TVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNGIKVIVNTDVGEPFQRI
3bh0A           ENIKRLIVTAGSINAQKIKAARRDFASEDWGK---------LSMAIGEISNSNINIFDKAGQSVNYIWSK
2akaA           QILQANPILEAFGNAKTTRNNSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLL
2bkhA           NPLLEAFG---NAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLC
3bpbA           GAESRRGTEIIEETVQRFYPGVERIEAPGTVEAGDIMMVGDH------------FYIGESARTNAEGARQ
1dhjA           ---------------------------------------------------------LAWFKRNTLDKPV
3bgwA           ENI--KRLIVTAGSINAQKIKAARRDFASEDWGKLSM-------------AIGEISNSNINIFDKAGQSV
1e0jA           EETAEDLIGLHNRVRLRQSDSLKREIIENGKF---------DQWFDELFGNDTFHLYDSFAEAETDRLLA
2d0kA           ---------------------ALAVDRVIGNENA----------------LPWNLPADLAWFKRNTLNKV
3cr7D           IRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETKGLYKKAR
1e0jB           EE-TAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL--------YDSFAEAETDRLLA
2dr3F           QVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGI-----------------------GKSKEYEKYIVHDLT
1bg0A           WGDINLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDEL-KGTYYPLTGM
3ed8A           PIGDGP---VLLPDNHYLSYQTVLSKDPNEKR--------------------------------------
2bbtB           QNSWIMPGTIKENIIGVSYDEYRYRSVIKAC------------------QLEEDISKFAEKDNIVLGITL
2d3wC           ALSPEDRAGEGIFMAFQYPQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGF
1e3aB           EMNPKVYNPQSGYIAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGL
3c8uA           LDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRARDIAIAGAAEVGP--ECRVAII-
2dr3C           QVRQNMAQFGWDVKPYEEKGMFAMVDAFT--------------------------AGIGEYEKYIVHDLT
2a5jA           KQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDAR-QHSSSNMVIMLIGNKS
1e2gA           EIGKLLSSY--LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQG-----VTLVVDRYAFSGVAFTGAKE
3bo6B           FHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTL--YVKPDQENSQYSASS
2a30B           QMMYEKERWSFTFQTYACLQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWM
2d3wD           ALSPEDRAGEGIFMAFVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGF
3dm9B           GAIEQLEEHKVIKHSYGADPAAVAYDAIQ----------------------HAKARGIDVVLIDTAGRSE
3cbnA           --TAGHRTTFEVTVDPEIGTADCIIGVSSSDSISTLPDEKRAIARESLVRVILRTENGYDEIRGYGHPEL
3bb1D           SRSRAGFTLNIIDTPGLIEGGYINDMALNIIK--------------------------------------
3bb1D           ----------------------------------------------------------------------
1e59A           FAYTSLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRG----FAVTPPELT
3cmxA           PIY--ARKLGVDIDNLCSQPDTGEQALEICD---------------------------------------
3cmxA           ----------------------------------------------------------------------
1cr1A           VEETAEDLIGLHNRVRLRQSDSLKREIIENGK---------------FDQWFDELFGNDTFHLYDSFAEA
1cr0A           EETAEDLIGLHNRVRLRQSDSLKREIIENGKF----------------DQWFDELFGNDTFHLYDSFAEA
3bczC           CAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDED
3dhwC           SESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELL-SLVGLGDKHDSYPSNL
3d3qA           TAKVTTEEEGIPHYFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAF-----EISEDKKQ
3ecpA           ----------SVFSSAALGRRTARLVNVAAQLAKYSGKSITISSEGSKA-AQEGAYRFIRNPNVSAEAIR
1bmfC           VAIGQKRSTVAQLVKRLTDADA----------------------------MKYTIVVSATASDAAPLQYL
2bdtA           YRPPWENITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNRE-----ELLRRD
2ck3C           VAIGQKRSTVAQLVKRLTDADA----------------------------MKYTIVVSATASDAAPLQYL
2a2zB           STNVLQMMYEKPERWSFTFQTYACLSRIRAQLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIY
2cckB           GEEIRKIVLEDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNE
3dffA           AQDG--ANVLVYTVFAGAAQPPYSPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIY
1dvrA           GTQLGLEAKKIMDQGGLVSDDIMVNMIKDETNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAI
2b8tC           TGTSLPVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEP
1cr2A           EETAEDLIGLHNRVRLRQSDSLKREIIENGK-----------------FDQWFDELFGNDTFHLYDSFEA
3cr7A           --FGLNKDLGFSEADRNENIRRIAEVAK