[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55525.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bteA.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "3bicB.bssp"
#ERROR : Can't open dsspfile "2bvtA.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "3bicA.bssp"
#ERROR : Can't open dsspfile "1bs2A.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "1cjyB.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "3bjqI.bssp"
#ERROR : Can't open dsspfile "2ajgA.bssp"
#ERROR : Can't open dsspfile "3bjqF.bssp"
#ERROR : Can't open dsspfile "1ei5A.bssp"
#ERROR : Can't open dsspfile "2ajgB.bssp"
#ERROR : Can't open dsspfile "2ajhB.bssp"
#ERROR : Can't open dsspfile "2dlcX.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "2aelA.bssp"
#ERROR : Can't open dsspfile "2aelB.bssp"
#ERROR : Can't open dsspfile "2ab5B.bssp"
#ERROR : Can't open dsspfile "3c8zA.bssp"
#ERROR : Can't open dsspfile "3c98A.bssp"
#ERROR : Can't open dsspfile "2e50A.bssp"
#ERROR : Can't open dsspfile "2c1wC.bssp"
#ERROR : Can't open dsspfile "2e50B.bssp"
#ERROR : Can't open dsspfile "1b12C.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2azoB.bssp"
#ERROR : Can't open dsspfile "1a1xA.bssp"
#ERROR : Can't open dsspfile "3cglC.bssp"
#ERROR : Can't open dsspfile "2c1wB.bssp"
#ERROR : Can't open dsspfile "3cglD.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"
#ERROR : Can't open dsspfile "1bo6A.bssp"
#ERROR : Can't open dsspfile "2aekA.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "2crqA.bssp"
#ERROR : Can't open dsspfile "1cv7A.bssp"
#ERROR : Can't open dsspfile "2c1sA.bssp"
#ERROR : Can't open dsspfile "3dtiA.bssp"
#ERROR : Can't open dsspfile "2arlA.bssp"
#ERROR : Can't open dsspfile "3cfiJ.bssp"
#ERROR : Can't open dsspfile "3ecjA.bssp"
#ERROR : Can't open dsspfile "2azxA.bssp"
#ERROR : Can't open dsspfile "2bcrA.bssp"
#ERROR : Can't open dsspfile "3ci0I.bssp"
#ERROR : Can't open dsspfile "3dl5B.bssp"
#ERROR : Can't open dsspfile "2cybA.bssp"
#ERROR : Can't open dsspfile "2bcvA.bssp"
#ERROR : Can't open dsspfile "2adyA.bssp"
#ERROR : Can't open dsspfile "3c5fA.bssp"
#ERROR : Can't open dsspfile "2ahiC.bssp"
#ERROR : Can't open dsspfile "2bcqA.bssp"
#ERROR : Can't open dsspfile "2ahiA.bssp"
#ERROR : Can't open dsspfile "2e8gA.bssp"
#ERROR : Can't open dsspfile "3d0aA.bssp"
#ERROR : Can't open dsspfile "2c1qA.bssp"
#ERROR : Can't open dsspfile "3d0aB.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2ac0D.bssp"
#ERROR : Can't open dsspfile "2ahiD.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "2ac0A.bssp"
#ERROR : Can't open dsspfile "2ataA.bssp"
#ERROR : Can't open dsspfile "3d0aC.bssp"
#ERROR : Can't open dsspfile "3d07B.bssp"
#ERROR : Can't open dsspfile "3egbB.bssp"
#ERROR : Can't open dsspfile "3d0aD.bssp"
#ERROR : Can't open dsspfile "2clpI.bssp"
#ERROR : Can't open dsspfile "2clpA.bssp"
#ERROR : Can't open dsspfile "3d07A.bssp"
#ERROR : Can't open dsspfile "2cycA.bssp"
#ERROR : Can't open dsspfile "1bdgA.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"
#ERROR : Can't open dsspfile "2b29A.bssp"
#ERROR : Can't open dsspfile "3ecjB.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "3c8zA.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"

## Summary of PDB Search
:948
    e-119  19%  2bteA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    2e-64   8%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    6e-62   8%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    2e-59  14%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    1e-54   8%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    5e-53  20%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    8e-53  16%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    7e-52  10%  3bicB  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    2e-51   8%  2bvtA  [x.x.x] BETA-1,4-MANNANASE
    2e-50  20%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    6e-49  20%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    6e-48  11%  3bicA  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    1e-47   9%  1bs2A  [d.67.2 - c.26.1 - a.27.1] PROTEIN (ARGINYL-TRNA SYNTHETASE)
    2e-46   7%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    2e-44   9%  1cjyB  [b.7.1 - c.19.1] PROTEIN (CYTOSOLIC PHOSPHOLIPASE A2)
    5e-44   6%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    8e-44  10%  3bjqI  [x.x.x] PHAGE-RELATED PROTEIN
    8e-38  22%  2ajgA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    2e-37   8%  3bjqF  [x.x.x] PHAGE-RELATED PROTEIN
    3e-36   7%  1ei5A  [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE
    3e-35  23%  2ajgB  [x.x.x] LEUCYL-TRNA SYNTHETASE
    8e-35  24%  2ajhB  [x.x.x] LEUCYL-TRNA SYNTHETASE
    3e-34   7%  2dlcX  [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
    8e-34  14%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    4e-33  11%  2aelA  [x.x.x] TRICHODIENE SYNTHASE
    1e-32  11%  2aelB  [x.x.x] TRICHODIENE SYNTHASE
    2e-32   9%  2ab5B  [x.x.x] MRNA MATURASE
    8e-32  14%  3c8zA  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    7e-31   8%  3c98A  [e.25.1 (1dn1A)] SYNTAXIN-BINDING PROTEIN 1
    2e-30  13%  2e50A  [x.x.x] PROTEIN SET
    6e-30  11%  2c1wC  [x.x.x] ENDOU PROTEIN
    6e-30  13%  2e50B  [x.x.x] PROTEIN SET
    2e-29  12%  1b12C  [b.87.1] SIGNAL PEPTIDASE I
    6e-28  13%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    5e-27  12%  2azoB  [c.52.1] MUTH
    2e-26  13%  1a1xA  [x.x.x] HMTCP-1
    5e-26  10%  3cglC  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    6e-24   7%  2c1wB  [x.x.x] ENDOU PROTEIN
    4e-23  11%  3cglD  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    7e-22  12%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    3e-21  10%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    4e-21  10%  1bo6A  [c.37.1] ESTROGEN SULFOTRANSFERASE
    2e-20  13%  2aekA  [x.x.x] TRICHODIENE SYNTHASE
    7e-20  12%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE
    8e-20   8%  2crqA  [x.x.x] MITOCHONDRIAL TRANSLATIONAL INITIATION FACTOR 3
    1e-19  10%  1cv7A  [d.22.1] GREEN FLUORESCENT PROTEIN
    2e-18  10%  2c1sA  [x.x.x] BIOTIN BINDING PROTEIN A
    2e-17  12%  3dtiA  [x.x.x] IRRE PROTEIN
    3e-17  12%  2arlA  [x.x.x] GFP-LIKE NON-FLUORESCENT CHROMOPROTEIN
    5e-17  11%  3cfiJ  [x.x.x] TYPE II SECRETORY PATHWAY, PSEUDOPILIN EPSI
    5e-17   6%  3ecjA  [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)
    9e-17   9%  2azxA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-16  11%  2bcrA  [x.x.x] DNA POLYMERASE LAMBDA
    3e-15   7%  3ci0I  [x.x.x] PSEUDOPILIN GSPI
    6e-15   9%  3dl5B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    4e-14  14%  2cybA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-14  10%  2bcvA  [x.x.x] DNA POLYMERASE LAMBDA
    5e-14  14%  2adyA  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    8e-14  10%  3c5fA  [x.x.x] DNA POLYMERASE LAMBDA
    8e-14  14%  2ahiC  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    1e-13  11%  2bcqA  [x.x.x] DNA POLYMERASE LAMBDA
    1e-13  14%  2ahiA  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    1e-13   7%  2e8gA  [x.x.x] HYPOTHETICAL PROTEIN PH0536
    2e-13  14%  3d0aA  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    3e-13  12%  2c1qA  [x.x.x] BIOTIN BINDING PROTEIN A
    3e-13  14%  3d0aB  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    4e-13  18%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    4e-13  14%  2ac0D  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    4e-13  14%  2ahiD  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    5e-13   8%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    9e-13  14%  2ac0A  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    2e-12  14%  2ataA  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    6e-12  10%  3d0aC  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    3e-11  10%  3d07B  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    1e-10  12%  3egbB  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    1e-10  10%  3d0aD  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    1e-09  11%  2clpI  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    3e-08  12%  2clpA  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    3e-08  14%  3d07A  [x.x.x] CELLULAR TUMOR ANTIGEN P53
    3e-08  10%  2cycA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    2e-06  12%  1bdgA  [x.x.x] HEXOKINASE
    1e-05  14%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
    1e-05  16%  2b29A  [x.x.x] REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT
    6e-05   7%  3ecjB  [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)
    2e-12  21%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 48->199)
    3e-17  18%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 50->233)
    2e-13  18%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 48->244)
    7e-18  22%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 50->201)
    6e-17  22%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 50->204)
    4e-24  12%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE(query 415->742)
    4e-25  11%  3c8zA  [x.x.x] CYSTEINYL-TRNA SYNTHETASE(query 388->742)
    3e-05  14%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE(query 33->227)
    1e-07  12%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE(query 58->245)
:948

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANTYKETMNLPKTDFAMRANLPESEPKRLAKWEEEHIYEQVLEKNKDGKPFILHDGPPYANGPIHIGHA
2bteA           ------------------KYNPHAIEAKWQRFWEEKGFMKAK-DLPGGRGKQYVLVMFPYPSGDLHMGHL
1abbA           AKWVDTQVVLAMPYDTPVPGYVVNTMRLWSAKAPNDFNLKDFNVGGLDRNLAENISRVLYPEGKERLKQE
2amvA           ------QVVLAMPYDTPVPGYRNNTMRLWSAKAPNDFNLKGYIQAVLDRNLAENISRVLYPNDNFFEGKE
2csxA           ----------------------------------------------------------------------
1c8kA           ---TQVVLAMPYDTPVPGYRNVVNTMRLWSAKAPNDFNLKGYIQAVLDRNLAENISRVLYPNDNFFEGKE
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
1bs2A           --GDFLEKVEANGPFIQFFFNPQFLAKLVIPDILTRKEDYGSCKLVEN-KKVIIEFSSPNIAKPFHAGHL
1axrA           ----DTQVVLAMPYDTPVPGYRNNTMRLWSAKAPNDFNLKDFNVGGLDRNLAENISRVLYPNDNFFEGKE
1cjyB           ----------------------------------------------------------------------
3e3nF           -----------WVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNGYIQVLDRNLAENISRVLYGKEL
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           -----------------PNEAFGLITKNLQEVLNPQIIKDVLEVQ---KRHLKLYWGT-APTGRPHCGYF
3c8zB           -----------------MQSWSAPAIPVVPGRGPALRLFDSAVRPVTPGPTATMYVCGITPYDATHLGHA
2aelA           --GHCVGASLWPKEQFNERSLFLEITSAIAQMENWMVWVNDLMEFDDERDQISLVKNYVVSDEI-SLHEA
2aelB           --GHCVGASLWPKEQFNERSLFLEITSAIAQMENWMVWVNDLMSFDDERDQISLVKNYVVSDE-ISLHEA
2ab5B           ----------------------------------------------------------------------
3c8zA           -----------------MQSWSAPAIPVVPGRGPALRLFDSAVRPVTPGPTATMYVCGITPYDATHLGHA
3c98A           ----------------------------------------------------------------------
2e50A           ----------------------------------------------------------------------
2c1wC           ------------------------------KLFNE--LWDADQNRMKSGKDYRLQGKAGYVSFPLFQFVD
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2c1wB           -----------------------QNRMKSGKDYRISLQGKAGYVPSASFPLFQFVDEE-KLKSRKTFAT-
3cglD           ----------------------------------------------------------------------
2cfoA           ---------------------------------------------------------APSPTGNLHIGTA
2cfoB           ----------------------------------------------------------------------
1bo6A           ----------------------------------------------------------------------
2aekA           ----CVGASLWPKEQFNERSLFLEITSAIAQMENWNDLMSFYKEFDDERDQISLVKNY-VVSDEISLHEA
2cybB           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------CELQGLWRNELGSNMTISALDVAGT--FSGSYQTAVTATNKQILVSPL
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           ----YDKLIVRFGSDKELINRIERATGQRPHHFLRRGIFFSHVLDAYENKKPFYLYTGRGPSSEAHVGHL
2bcrA           --------RRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQGQQQKYLGVCRLPGPG
3ci0I           ----------------------------------------------------------------------
3dl5B           ------------------------------GAYRENRTGISTYSIFGQMMRFDMRESFPLLFIRSIFEEL
2cybA           ----------------------------------------------------------------------
2bcvA           ---------------GDVDVLITHPDGRSHRGIFSRLLDSLRFLTDDLVSQEENGQQQKYLGVCRLPGPG
2adyA           ----------------------------------------------------------------------
3c5fA           --------GSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVC
2ahiC           ----------------------------------------------------------------------
2bcqA           ---ACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDQEENGQQQKYLGVCRLPGPG
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           -------------------------------LWRNELGSNMTISALDVAGTFSGSYQTAVTATNKQILVS
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ---------------------------------------------------------GIQPSGVITIGNY
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ---KYGELVVLGKSRFALYVHVISTCKGQHSISYTLSRNQTVVV---------EYTHDK-DTDMFQVGRS
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           -----------------IEERINLVLKKPTEEVLTVENLRHLFEIGA---PLQHYIGF-EISGYIHLGTG
1bdgA           ----------------------------------------------------------------------
1b25A           --------------------------------RAYWVREFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHL
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           -----------------------------------------------LMKKFYVTTPIYYVNDVPHLGHA
2d5bA           -------------------------------------------------KVFYVTTPIYYVNAEPHLGHA
2ct8A           -----------------------------------------------LMKKFYVTTPIYYVNDVPHLGHA
2d54A           -------------------------------------------------KVFYVTTPIYYVNAEPHLGHA
1a8hA           -------------------------------------------------KVFYVTTPIYYVNAEPHLGHA
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           --------------------------------ISEEELREVLKKDEKSALIG------FEPSGKIHLGHY
2cfoB           ---------------------------------------------------------APSPTGNLHIGTA


                         .         .         *         .         .         .         .:140
query           FNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTLGPDKMAKIDQPTLRRLCREWAEKYVDVQR
2bteA           KNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKF--------------GVHPKDWTYANIRQAK
1abbA           YFVVLQDIIRRFK-SSKFGCRDPVRTNFDAFPDKVAIQLNDT--HPSLAIPELMRVLVDLERLDWDK---
2amvA           LRLKQEYFIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPEL------MRVLVDLERLDWD
2csxA           ----------------------------------------------------------------------
1c8kA           LRATLQDIIRRFK-SSKFGCRDPVRTNFDAFPDKVAIQLNDT--HPSLAIPELMRVLVDLERLDWDK---
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
1bs2A           RSTIIGGFLANLYEKLGWEVIRMNYLGDWGKQFGLLAVGFERYGN------------EEALVKDPIHHLF
1axrA           LRATLQDII-RRFKSSKFGCRDPVRTNFDAFPDKVAIQLND--THPSLAIPELMRVLVDLERLDWDKAWE
1cjyB           ----------------------------------------------------------------------
3e3nF           RLKQEYFVVAATFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPE-------LMRVLVDLERLDW
3bjqI           --ARVVDPILSTHA--RGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNTKRIDFGYEGDPYSIV
2ajgA           ----------------------------------------------------------------------
3bjqF           ---------------------------------------------------------FRLYNTKRAPGAN
1ei5A           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           VP----MTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEV-----------------VNYRAKYYELTIK
3c8zB           ATYLTFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERDGID--------------WRTLGDRETQLFR
2aelA           LEKLTQDTLHSSKVFSDKDPQVMDTIECFMHGYVTWHLCDR------KYRLSEIYEKVKEEKTEDAQKFC
2aelB           LEKLTQDTLHSSKVFSDKDPQVMDTIECFMHGYVTWHLCDR------KYRLSEIYEKVKEEKTEDAQKFC
2ab5B           ----------------------------------------------------------------------
3c8zA           ATYLTFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERD--------------GIDWRTLGDRETQLFR
3c98A           ----------------------------------------------------------------------
2e50A           ----------------------------------------------------------------------
2c1wC           EEKLKRKTFATFISLLDN-YEMDTGVAEVVTPEEIAEN----------------NNFLDAILETKV----
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1xA           --------------------------EDVGAPPDHLWVHQEG------IYRDEYQRTWVAVVEEETSFLR
3cglC           ----------------------------------------------------------------------
2c1wB           ------------FISLLDNYEMDTGVAEVVTPEE--------------------IAENNNFLDAILETKV
3cglD           ----------------------------------------------------------------------
2cfoA           RTAVFNW-----LYARHRGGKFILRIEDTDR---------------------------ERSRPEYTENIL
2cfoB           ----------------------------------------------------------------------
1bo6A           ----------------------------------------------------------------------
2aekA           LEKLTQDTLHSSKQMVAVFPQVMDTIECFMHGYVTWHLC-------------------------------
2cybB           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           KGAQQPPGTKGQQPTFGFWQFADSTTVFVGQCFVDRRGK--------------EMLEMAWLLREEVPSRK
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           --------INTVGYLEQK---MFAAMVADNQMAMVMLNPKNLKASN---GEEELAGQTWYWKVAPVATTQ
3ecjA           ----------------------------------------------------------------------
2azxA           IPFIFTKW----LQDVFNVPLVIQTDDEKYLWKDLTLDQA---YGDAVENAKDIIACGFDINKTFIFSDL
2bcrA           RRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKT----------------KGMSLSEHALSTAVV
3ci0I           ------------------------EKTVAGWVAENQTALLYLTRGQRAVRQQSDAGSRWYWRTTPLS-TG
3dl5B           IWFIKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHREE----------------------NDLGPIYG
2cybA           ----------------------------------------------------------------------
2bcvA           RRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGM----------------SLSEHALSTAVV
2adyA           ----------------------------------------------------------------------
3c5fA           RHRRL-DIIVVPYSEFACALLYFTGSAHFNRSMAALAKTKGM----------SLSEHALS------TAVV
2ahiC           ----------------------------------------------------------------------
2bcqA           RRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGM----------SLSEHALS------TAVV
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           PLKGAQQPPKGQQPTFGFWQFADSTTVFVGQCFVDRRGKE--------------MLEMAWLLREEVPSRK
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           IGALRQFVELQH------------EYNCYFCIVD---------QHAITVWQ------DPHELRQNIRRLA
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           TESPIDFVVTDTQI-TQSTISRFACRIVCDRNEP----------YTARIFAA------GFDSSKNIFLGE
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           ---LMAGAKIADFQKAGIKTRVFLA-DWHSWINDKLGGD--------------LEVIQEVALKYFKVGME
1bdgA           ----------------------------------------------------------------------
1b25A           DEKKYDELLSEYY--------RIRGWDERGIPKKETLKELDLDFVIPELEK-------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           YTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPK--------------ELVDRNAERFK
2d5bA           YTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQA--------------AGEDPKAFVDRVSGRFK
2ct8A           YTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEEL--------------GISPKELVDRNAERFK
2d54A           YTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRA--------------AQAAGEDPKAFVDRVSGRFK
1a8hA           YTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQ--------------AAGEDPKAFVDRVSGRFK
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           L-QIKKMIDLQNA-----------GFDIIILLADLHAYLNQKGEL--------------DEIRKIGDYNK
2cfoB           RTAVFNW-----LYARHRGGKFILRIEDTDRER---------------------------SRPEYTENIL


                         +         .         .         .         .         *         .:210
query           EGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIEYSDETSP
2bteA           ESLRLMGILYDWDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGKRELE
1abbA           --AWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLV
2amvA           KAWEVTVKTCAYTN-HTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLV
2csxA           ----------------------------------------------------------------------
1c8kA           --AWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLV
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
1bs2A           DVYVRINKDIEEEGDSIPLEQSTNGKAREYFKRMEDGDEEALKIWKRFREFSIEKYIDTYARLNIKYDVY
1axrA           VTTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKR
1cjyB           ----------------------------------------------------------------------
3e3nF           DKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLV
3bjqI           PSALEAKVPRELRDASQVPGIDLGARTVLRIALAHEHECAQIALDPAKYNADHKVKLVGSARWTS----P
2ajgA           ----------------------------------------------------------------------
3bjqF           TKIDFGYEGDPYSIVPSALEAKVPRELRDASQVPGLGARSVNTVLRIALAHEHECIALDPAKYNADHKVK
1ei5A           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           AILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQAL
3c8zB           EDMAALRVLPPHDYVAAT---DAIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYDRD
2aelA           KFYEQAANVGAVSPSEWAYPPVAQLANV------------------------------------------
2aelB           KFYEQAANVGAVSPSEWAYPPVAQLANV------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           EDMAALRVLPPHDYVA---ATDAIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYDRD
3c98A           ----------------------------------------------------------------------
2e50A           ----------------------------------------------------------------------
2c1wC           --MKMAHDYLVRKNQAKPTRNDFKVQLYNIWFQLYSRAPGSRPDSCGFEHVFVGESKRGQEMMGLHNWV-
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1xA           ARVQQIQVPLGDAARPSHLLTSQLP-----LMWQLYPEERYMDNNSRLWQIQHHLMVRGVQ---------
3cglC           ----------------------------------------------------------------------
2c1wB           --MKMAHDYLVRKNQAKPTRNDFKVQLYNIWFQLYSRAPGSRPDSCGFEHVFVGESKRGQEMMGLHNWV-
3cglD           ----------------------------------------------------------------------
2cfoA           EGLQWLGLTWDEGPYF---QSDRLDLYRQAIQTLLDKGLAYYCYCTPEELEALR----------------
2cfoB           ----------------------------------------------------------------------
1bo6A           ----------------------------------------------------------------------
2aekA           -------DRKYRLSEIYEKVKEEKTEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN-----------
2cybB           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           DTWKATRVGTNV----------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           PLLKAFDVSVAAEKQASPIITVR-----------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           DYGS-----SGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQC
2bcrA           RNTHGCKVGPGRVLP--TPTEK------DVFRLL---GLPYREPAERDW---------------------
3ci0I           NALQAVDIEVSLHEDFSSVIQSRRA---------------------------------------------
3dl5B           FQWRHYNGEYKTMHD--DYTGVGVDQLAKLIETLKNNPKDRRHALSQMALPPCHV---------------
2cybA           ----------------------------------------------------------------------
2bcvA           RNTHGCKVGPGRVLPTPTEK--------DVFRLL---GLPYREPAERDW---------------------
2adyA           ----------------------------------------------------------------------
3c5fA           RNTHGCKV--GPGRVLPTPTEK------DVFRLL---GLPYREPAERDW---------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           RNTHGCKVGPGRVLPTPTEK--------DVFRLL---GLPYREPAERDW---------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           DTWKATRVGTNV----------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ALYLAVGIDPTQATLFIQS----------EVPAHAQAAWMLQCIVYIGELERMTQFKEKS----------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           KAAKWKNPDGHMDGLTTNGVLVMHPRQPGVWREISVCGDVY--TLRETRSAQQRGKLVESETN-------
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           KSIEVMGGDPKKVEFVLASEILEKGDYWQTVIDISKNVTLSRVMRSITIMGRQMGEAIDFAKLIYPMMQV
1bdgA           ----DSLHPGKQLYEKMVSGMYLGELVRHIIVYLVEQKILFRGDLPERLKVRNSLLTRYLTDVERDPALY
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           KLWEFL--KIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYKEPSYFFRLSKYQD-----------
2d5bA           RAWDLLGIAYDDFIRT--TEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEHGRPVE
2ct8A           KLWEFLKI--EYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNP
2d54A           RAWDLLGI--AYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKE---------
1a8hA           RAWDLLGIAYDDFIR--TTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVE------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           KVFEAMGLKAKYVYGSSFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPVNPLHYEG
2cfoB           EGLQWLGLTWDEGPYF---QSDRLDLYRQAIQTLL-----DKGLAYYCYCTPEELEALRAEQKAKGQAPR


                         .         .         .         +         .         .         .:280
query           SIFVKFKMDIMPGMFETAGAAGDAYVLIWTTTPWTLPANTAVSLAPDADYVMVQADGSNMIMARELVEQV
2bteA           QWYLRITDLEGLNWPEKVKAMQRAWIGVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAA
1abbA           EEGAVKR------------INMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYE-LEPHKFQNKTNGITP
2amvA           EEGAVKRINMAHLCIA-----GSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCN
2csxA           ----------------------------------------------------------------------
1c8kA           EEGAVKRINMAHLCIAGS-----HAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCN
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
1bs2A           SGESQVSKESMLKAIDLFKEKGLTHEDKGAVLIDL---TKFNKKLGKAIVQKSDGTTLYLTRDVGAAMDR
1axrA           INMAHLCIA-----------GSHAVNGVARIHSEILKKTI----------------------FKDFYELE
1cjyB           ----------------------------------------------------------------------
3e3nF           EEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYE---LEPHKFQNKTNGITPRRWLVLCNPG
3bjqI           DSDPTKDVET-----------AKEAIADSIGEPNRLLSRKALSACKYHPKLIERV---------------
2ajgA           -VEITFNVN-----------DYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAA---FIDE
3bjqF           VGSARWTSPDSDPTKDVETA--KEAIADSIGEPNRLLSRKALSACKYHPK--------------------
1ei5A           ----------------------------------------------------------------------
2ajgB           ---------------------YDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFI--DEC
2ajhB           ---------------------YDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRT
2dlcX           DEQFVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLANSKIDLLEEPKQVKKKINSASPGNVEENGLLS
3c8zB           TMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEP-----------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           TMLTLFAERGGDPDR-------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2e50A           --------------------------------------SAQAAKVSKKELNSDETSEKEQQEAIEHIDEV
2c1wC           ----------------------------------------------------------------------
2e50B           --------------------------------------------------------EKEQQEAIEHIDEV
1b12C           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
1bo6A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           LIPCAIDQDPYFRTRDVAPRIGYPKPLQGAQTKSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEH
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           ADIFYQGVTIAHAG--------------------------------------------------------
1bdgA           NTHYMLTDDLHVPVVEPIDNRIVRYACEMVVKAAYLAGAGIACILRRISEVTVGVDGSHPKFCERMTDMV
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2d5bA           RRKEGNYFFRMEKYRPWLQEYIQ-----------------------------------------------
2ct8A           EFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKW------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           VDVAVGGMEQRKIHMLA-----------------------------------------------------
2cfoB           YDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQI-----------------------------------


                         .         *         .         .         .         .         +:350
query           AEIAGWESYDLVRGEDGEPVALKGREFTGLTYTCPVRQDLKGTIIYGDHVTLDSGTGAVHTAPGHGQDDY
2bteA           KRKTEIERQAEGR--------EKTGVFLGAYALNP-ATGERIPIWTADYVLFGYGTGAIMAVPAHDQRDY
1abbA           RRWLVLCNPGLAEIIA---------ERIGEEYISDL-DQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAY
2amvA           PGLAEIIAE------------RIGEEYISDLDQLRKLLSYVDDEAFIRDVA-------KVKQENKLKFAA
2csxA           -----------------------------------------------------YVNDVPHLGHAYTTIAA
1c8kA           PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLAYLEREYKVHINPNSLFDVQVKR
2d5bA           -------------------------------------------GTDEHGETVYRAAQAAGEDPKAFVDRV
2ct8A           -----------------------------------------------------YVNDVPHLGHAYTTIAY
3bicB           ----------------------------------------------------------------------
2bvtA           ------------------------------------------TRSLLSYLDGVRGEGIL--FGHQHTTSF
2d54A           -------------------------------------------GTDEHGETVYRAAQAAGEDPKAFVDRV
1a8hA           -------------------------------------------GTDEHGETVYRAAQAAGEDPKAFVDRV
3bicA           ----------------------------------------------------------------------
1bs2A           YEKYHFDKMIYVIASQQDLAAQFFEILKQMGFEWAKDLQHVNFGMVQGMSTKGTVVFLDNILEETKEKNK
1axrA           PHKFQNK----------------------TNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLS
1cjyB           ----------------------------------------------------------------------
3e3nF           LAEIIAERIGEEYISDLDQLRKL---------------------LSYVDDEAFIRDVAKVKQENKLKFAA
3bjqI           --------------SITIDLKALWEVEEIVVGTARV------ATSFGDVWGPDVWLGYVSDNPDPSVEEP
2ajgA           CRNTKVAEAEMATME-------KKGVDTGFKAVHPL-TGEEIPVWAANFVLMEYGTGAVMAVPGHDQRDY
3bjqF           --------LIEITIDLKALWEVEEI-------------VVGTARVATDSFGDVWGPDVWLGYVSDNPDPS
1ei5A           -------------------------------------------LCGADPEGVFLPAQAQSLLRRLKTTHF
2ajgB           RNE-------------------KKGVDTGFKAVHPL-TGEEIPVWAANFVLMEYGTGAVMAVPGHDQRDY
2ajhB           ME--------------------KKGVDTGFKAVHPLT-GEEIPVWAANFVLMEYGTGAVMAVPGHDQRDY
2dlcX           FVQYVIAPIQELKFGTNHFEFFIDRPE--KFGGPITYKSFE--EMKLAFKEEKLSPPDLKIGVADAINEL
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2e50A           QNEIDRLNEQASE-------EILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDE
2c1wC           ----------------------------------------------------------------------
2e50B           QNEIDRLNEQASE-------EILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDE
1b12C           ----IYEPFQIPSGSMMP--TLLIGDF--ILVEKFATGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKV
2ag6A           ----------------------------------------------------------------------
2azoB           -----------------------------------------GLVTPENLKRDKGWIGVLASAGSKPEQDF
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
1bo6A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------LVFSSNIGQHDL
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           RQFGGNC---------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           -----------------------------------------GAMEMGRRMDAPTSAAVTRAFLERGHTEI
2clpA           -----------------------------------------GAMEMGRRMDAPTSAAVTRAFLERGHTEI
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           DKLKPKNRFCLRLSEDG-----------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LVALEFDVPLLMPVDDNGVLTDEAGPFAGLDVDEANPVIIEWLRERGTLVAQKEILHSYPHCWRCHEPVI
2bteA           EFARKFGLPIKKVIYEEPGIMVNSGPFDGTESEEGKRKVIAWLEEKGLGKGRVTYRLRDWLISRQRYWG-
1abbA           LEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKM
2amvA           YLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAK
2csxA           DTIARYYRLRDYDVFFLTGTDEHGLKIKKAEELGISPKELVDRNAERFKKLWEFLKIEYTKFIRTTDPYH
1c8kA           IHEYKRQLLNCLHVITLYNRIKKEPFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLR
2d5bA           SGRFKRAWDLLGIAYDDFIRTTEERHKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVE
2ct8A           YRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKK-----LWEFLKIEYTKFIRTTDPYH
3bicB           ----------------------------------------------------------------------
2bvtA           GLTTGPTDGTTSDVKNVTGDFPA---VFGWDTLIIEGNERPGLAENTRDENIALADYIRKADAIGGVNTV
2d54A           SGRFKRAWDLLGIAYDDFIRTTEERHKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVE
1a8hA           SGRFKRAWDLLGIAYDDFIRTTEERHKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVE
3bicA           ----------------------------------------------------------------------
1bs2A           YAQIEHPEEVADLVGISAVIQDMQGKRINNYEFKWERMLSFEGDTGPYLQYAHSRLRSVERNASGITQEK
1axrA           YVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE
1cjyB           ---------------------------------------STLYSHPDFPEKGPEEINEELMKNVSHNPLL
3e3nF           YLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAK
3bjqI           SFGYTYQIEGHPLVEVPY--WDNNAKSWIYGVSDDNTPAL--SGLAGYLIEDAGLPA-------------
2ajgA           EFASKYGLNIKPVILAADGSEPDLGEFNGLDHEAAFNAIADKLTAMGVGERK------------------
3bjqF           VEEPSFGYTYQIEGLVEVPYWDNNAKSWIYGVSDDNTPAL--SGLAGYLIEDAG----------------
1ei5A           EPGSHYSYCNGNFRILADLIEAHTGRTLV-DILSERIFAPAGMKRAELISDTALFDECTGYEGDTVRGFL
2ajgB           EFASKYGLNIKPVILAADGSEPDLGEFNGLDHEAAFNAIADKLTAMGVGERK------------------
2ajhB           EFASKYGLNIKPVILAADGSEPDLGEFNGLDHEAAFNAIADKLTAMGVGERK------------------
2dlcX           LEPIR-----------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2e50A           EAM-----HYLTRVEVTEF-EDIKSGYRIDFYFDEN-----PYFENKVLSKEFHSSKSTEIKWKSGKDMF
2c1wC           ----------------------------------------------------------------------
2e50B           EAMHYLTRV------EVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHMSS----KSTEIKWKSGKDMF
1b12C           TYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSATSGFFEVPKNETKENGIRLSERKETLG
2ag6A           -------------------------------------------------------------------EMI
2azoB           AAVELKTIPVDSLGRPLETTFVCVAPLTGSGVTWETSHVRHKLKRVLWIPVEG-ERSIPLAQRRVGSPLL
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2cfoB           ---------------------------------------------RTAVFNWLYARHRGGKFILRIEDTD
1bo6A           ------------GVLMDKRFTKYWEDVEMFLARPDDLVIATWISEEGDAIFNRIPYLECRNEDLINGIKQ
2aekA           ----------------------------------------------------------------------
2cybB           --------------------------------------AEEVVTEEELRQLIETKEKPRAYVGY--EPSG
2crqA           DTKSKQI----QQWIEKKYHVQVTIKRRKDATEEIFNQILQTMPDIA-TFSSRPKAIRGGTASMC-----
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           -----------------------------------ALYALAERTAPPVIYAVCALSLTVRASSASAGVKY
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           -----------QDDEGTTYAAWMHRKGTVHDTALTGGNGPRLHHVAFSTHEKHNIIQICDKMGALRISDR
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           --------------------------------KTTFRPDRRLQLAHEGSLMKALYTHLQTRTWTIN-PTG
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           DTAFVYSEGQLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVT
2clpA           DTAEGQSETILGGLDCRVKIDTKAIPLFG--NSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPV-
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           --------PILQVINIRPITTGNSPPSDGLNTLQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVIL-
3ecjB           --------------------------------------------------------QICDKMGALRISDR
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------LFERAE
3c8zA           -------------------------------------LVHRLWLDAGHTV------QYVQNVTDVDDPLF
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FRATDQWFVSMDKNSLRENALKAIENDVEWIPAWASNRIGSMVADRPDWCISRQRSWGVPIPVFKCAKCG
2bteA           -TPIPMVHCEACGVPVPEEELPVLLPDLKDVEDI-RPKGKSPLEAHPEFYETTCPKCGGPASSWYYLRYT
1abbA           IIKLITAIGDVVNHDPVVGDRL---RVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNG
2amvA           MIIKLITAIGDVVN--HDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNG
2csxA           VKFVQKVFEEC-----YKRGDIYLGEYKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQG
1c8kA           VIFLENYRVSLAEKVIPA---ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENF
2d5bA           RRKEGNYFFRMEKYRPWLQEYIQ-ENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDE-
2ct8A           VKFVQKVFEECYKRGDIYLG----EYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQG
3bicB           ---HPEWAALAKGKNPEDLIWHTPEG-ISIKPLYSKRDTMDLPEELPYPTMYTFRPWTIRQYAGFSTVEE
2bvtA           SAHVENFVTGGSFY-----DTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHE
2d54A           RRKEGNYFFRMEKYRPWLQEYIQ-ENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLP----
1a8hA           RRKEGNYFFRMEKYRPWLQEYI-QENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDE-
3bicA           -----EWAALAKKKNPEDLIWHTPEG-ISIKPLYSKRDTMDLPEELPYPTMYTFRPWTIRQYAGFSTVEE
1bs2A           WINADFSLLKEPA---AKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVSSCYDVLWVAGQTEEL
1axrA           PNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLS
1cjyB           LLTPQKVKRYVESLWKKKSS----GQPVTFTDIFGMLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTC
3e3nF           MIIKLITAIGDVVN--HDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMFMLNGA
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           PATNRIQWMGDAGICASLNDMIAWEQFIDATRDDESGLYRRLSGPQTFKDGVAAPYGFGLNLHEGKRLTG
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2e50A           F----TWFTADE---LGEVIKDDIPNPLQYY---------------------------------------
2c1wC           ----------------------------------------------------------------------
2e50B           F----TWFTGADE--LGEVIKDDIWPNYYLVP--------------------------------------
1b12C           DVTHRILTVPIAQ--DQVGMYYQQPG-QQLATWIVPPGQ-YFMMGDNRDNSADSRYWG-FVPEANL----
2ag6A           KRNTSEIISEEE---LREVLKKDEKS-ALIGFESGKIHLGHYLQIKKMIDLQN---AGFDIIILLADLHA
2azoB           WSPNEEEDRQLRED--WEELMDMIV-LGQVERITA--RHGEYLQIRPKAANAKALILTLPRGFY------
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2cfoB           RERSRPEYTENILEGLQWLGLTWDEGPYDLYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAKGQAPRY
1bo6A           LKEKESPRIVKTH--LPPKLLPASFWEKNC-------KMIYLCRNAKDVAVSYYYFLLMITSYPNPKSFS
2aekA           ----------------------------------------------------------------------
2cybB           EIHLGHMMTVQKLMDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIALGLDES-RAKFVLG
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           SLSAGTPVPDDHPAALALDTRLPLA-QDSYVPFRSGRRMPAYV----DAFPERQRSFALP----------
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           IERGPGRHGVSNAFYLYILDPDNHR-IEIYTQDYYTGDPDNPTITWNVHDNQRRDWWGNPVVPSWYTEAS
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           IRATSIGNADVIG--LKTVATHSITD-VKSLPQSAVDEIFKINSLDVDSCLSH-----------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           LRACHQLHLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGG
2clpA           ----EETLRACHQ--LHQEGKFVELG-LSNYAAWEVAEICTLCKSNGWILPTVYQGM-------------
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           IERGPGRHGVSNAFYL-YILDPDNHRIEIYTQDYYTGDPDNPTITWNVHDNQRRDWWGNPVV--------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           RDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMV-EKLLASGAAYIVEDAEYPDVYFR
3c8zA           ERAERDGIDWRTLGDRETQLFREDMALPPHDYVAATDAIAEVVEMVE-KLLASGAAYIVEDAEYPDVYFR
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           STVANEQTFDAVIDLFYREGADAWFTREPSEYLPRGVKCETCGCTELTPEKDILDVWWESGVSHTSVLKH
2bteA           D-PHNDRLPFDPEKANAWMPVDQYIGGVEHAVLHLL-----YSRFFTKFLHDLGMVKVEEPFQGLFTQGM
1abbA           ALTIGTMDGANVEMAEEAGEENFFIFGMRVED----VDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFS
2amvA           ALTIGTMDGA-NVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAYDRIPELRQIIEQLSSGFFSPKQPDL
2csxA           LKDLSVTRPRSRVKWGIPVPFDPEH---------------------------TIYVWFDALFNYISALED
1c8kA           FIFGMR---VEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMMHHDRFKVFAD
2d5bA           --------------------------------------------------NHVTFVWFDALLNYVSALDY
2ct8A           LKDL-------------SVTRPRS--------------RVKWGIPVPFDPEHTIYVWFDALFNYISALED
3bicB           SNKF-------YKDNIKQQGLSVAFDLATHRGYDSD-------------NPRVRGDVGMAGVAI------
2bvtA           NAG-------------------SWFWWGAAYGS----PGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGN
2d54A           -----------------------------------------------WDENHVTAVWFDALLNYVSALDY
1a8hA           --------------------------------------------------NHVTYVWFDALLNYVSALDE
3bicA           SNKF-------YKDNIKQQGLSVAFDLATHRGYDSDNPRVR-------------GDVGMAG---------
1bs2A           AT-ARLALYGAARQVL------------------------------------------------------
1axrA           EQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFIFGMRVEDVDRLDQRGYNAQEYYDR
1cjyB           LHVKPDVSELMFADWVEFSPYEIGM-AKYGTFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSRV
3e3nF           LTIGTMDNVEMAEEAGEENFFIFGMRVEDVDRLDQRGY-------NAQEYYDRIPELRQIIEQLSSGFFS
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           HGGALRGWRCQRWHCADERLSTIAMFNFEGGASEVAFKLMNIALGVSSSEVSRVEADSAWFGSWLDDETG
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2e50A           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           YLNEIRKIGDYNKKVFEAMGLKAKYVYGSSFQLDLNVYRLALKTTLKRARRSMELIAREDEVAEVIYPIM
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------LHLEGTFNGHYFEIKGKGKGPNEGTNTVTLEVTKGGPLPFGWHILCPQFNKAVH
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------LHLEGTFNGHYFEIKGKGKGQPNEGTNTVTLETKGGPLPFGWHILCPQFNKAFH
2cfoA           -------------------------------------QDLVRGRVSWQGADLGGDMVIARAAPRGEIGLV
2cfoB           DNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVSWLGGDMVIARAAPRGEIGYPLYNLV
1bo6A           EFVEKFMQGQVPYGSWYDHVKAWWEKSKNSRVLFFYEDMKEDIRREVVKLIEFLERKPSAELVDRIIQHE
2aekA           ----------------------------------------------------------------------
2cybB           SEYQLSRDY-------------VLDVL----------KMARITTLNRARRSMDEVSRRKEDPMVSQMIYP
2crqA           ----------------------------------------------------------------------
1cv7A           ---------------FSVSGEGEGDATYGKLTL-----KFICTTGKLPVPWPTLVTTLVQCFSRYPDHMK
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           ------------------------------------------------TKGGPLPFAWDILSPQCSIPDI
3cfiJ           ----------------------------------------------------------------------
3ecjA           KVL-------------DLDGNVQEIILRTDDSEL--EVTIGADGFSFTRAGDEDGSYHGQASKGFKL---
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           --------------------------------------LKMARITTLNRARRSMDEVSRRKEDPMVSQMI
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           -----PSWYTEASKVLDLDGNVQEIILRTDDSELE--VTIGADGFSFTRAGD------------------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           A----DATAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHV
3c8zA           ADATAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHVECSA
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           REAEGLRFPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDGEGRKMSKSLGNGVDPAEV
2bteA           VLAWVEVEGSVVRLPEPTRIRLEIPESALSLEDVRKMGAELRPHEDGTLHLWKPAVMSKSKGNGVMVGPF
1abbA           PK------QPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREW-TRMVIRNIATKFSSDRT
2amvA           KDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIRATSGKFSSDRTIAQYAREGVEPSRQ
2csxA           KVEIY--WPADLHLVGKDILRFHTVYWPAFLMSLGYELPK--KVFAHGWWTVEGKKMSKTLGNVVDPYEV
1c8kA           Y--EEYVKCQERVSALYKNPREWTRMVIRNIATSGKFSSDRTI---------------------------
2d5bA           GEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVG-GFLLGPDGRKMSKTLGNVVDPFAL
2ct8A           KVEI--YWPADLHLVGKDILRFHTVYWPAFLMSLGYELPK--KVFAHGWWTVEGKKMSKTLGNVVDPYEV
3bicB           ----------DTVEDTKILFDGIPLEKMSVSMT--MNGAVIPVLANF---------IVTGEEQGVPKEKL
2bvtA           RDVYLRTYPGDAFVDVSTGSDAFLAGLVADLRMIAEIADEKGKVTNGSSPAQWFTKVLAAIKADPVASRN
2d54A           PEGEAYRWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVG-GFLLGPDGRKMSKTLGNVVDPFAL
1a8hA           GEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVG-GFLLGPDGRKMSKTLGNVVDPFAL
3bicA           -------VAIDTVEDTKILFDGIPLEKMSVSMT--MNGAVIPVLANF---------IVTGEEQGVPKEKL
1bs2A           ----------------------------------------------------------------------
1axrA           IPSSGFFSQPDLFKDIVNMLMHHDRFKVFADYEEYVKCERVSALYKNPREWTRMVIRNIATSGKFSSDRT
1cjyB           LGSTMEEELENITTKHIVSWIHRMIMALVSDSALFNTREGRAGKVHNFMLGLNDVKDSGLTFNLPYPLIL
3e3nF           PK------QPDLFKDIVNMLMHHDRFKVFADYEEYVKCQER-VSALYKNPREWTRMVIRNIAT-------
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           LVLSL--EDAGHGRMKARFGTSPEMMDVVSANEARVTTIRRDGETIELVRASENLRLSMKRVKGEAKHDI
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           -------------------------------------DNPIYAYIVGLFEGDGWITISKKGKYLLYELGI
3c8zA           ----------------------------------------------------------------------
3c98A           -----SMRMLSSCCKMTDIMTEGITIVEDINKRR----EPLPSLEAVYLITPSEKSVHSLISDFKDPPT-
2e50A           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           QVNPLHYEGVDVAVGGMEQRKIHMLARE------LLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDS
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           HPDNIHDYLKLSFPEGYTWERSMHFEDGGLCCSLTGNCFYYDIKFTGLNFPPNGPVVQKKTTGWEPSTER
2c1wB           ----------------------------------------------------------------------
3cglD           HPDNIHDYLKLSFPEGYTWERSMHFEDGGLCCSLTGNCFYYDIKFTGLNFPPNGPVVQKKTTGWEPSTER
2cfoA           VVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNF---AHTPLILNSTGQKLSKRDGVTSISDFR
2cfoB           VVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNF---AHTPLILNSTGQKLSKRDGVTSISDFR
1bo6A           MKNNPSTNYTMMPEEMMNQKVSPFMRKGIIGDWKNHFPEAL-----------------------------
2aekA           ----------------------------------------------------------------------
2cybB           QALDIAHLGVDLAVGGIDQ---RKIHMLARENLPRLGYSSPVCLHTPILVGLDGQKMSSSKGNYISVRDP
2crqA           ----------------------------------------------------------------------
1cv7A           QHDFFKSAPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNV
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           PDYVKQSFPEGFTWERIMNFEDGAVCTVSNDSSIQGNCFTYHVKFSGLNFPPNGPVMQKKTQGWEPSSER
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           QALDIAHLGVDLAVGGIDQ---RKIHMLARENLPRLGYSSPVCLHTPILVGLDGQKMSSSKGNYISVRDP
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           EALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGERRFARHYVHTGMIGVLVSQLRAQGVD-------
3c8zA           IALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGERRFARHYVHTGMIGVLVSQLRA-----------
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           MAKSGADVLRLWVASVDYSQDVSISDEILQRTSEAYRRIRNTFRFLLGSLDDFDDQKDAVSDWNALEPLD
2bteA           VKEQGADIARITILFAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQA----EALEGKD
1abbA           IAQYARE---IWGVE-------------------------------------------------------
2amvA           ----------------------------------------------------------------------
2csxA           VQEYGLDEVRYFLLEVPFGQDGDFSKKAILNNGELANEIGNLYSRVVNMAHKFLGGEV-------SGARD
1c8kA           ----------------------------------------------------------------------
2d5bA           LEKYGRDALRYYLLEIPYGQDTPVSEEALRYEADLADDLGNLVQRTRAMLFRFAEGRI-------PEPVA
2ct8A           VQEYGLDEVRYFLLEVPFGQDGDFSKKAIRINGELANEIGNLYSRVVNMAHKFLGGEV-------SGARD
3bicB           TGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEA----------GADA
2bvtA           ETWANFDAGQHFVPVPGDALLEDFQAYAADPFTLFASEVTVAAAPAQPVVHIASPADGARVA--------
2d54A           LEKYGRDALRYYLLEIPYGQDTPVSEEALRYEADLADDLGNLVQRTRAMLFRFAEGRI-------PEPVA
1a8hA           LEKYGRDALRYYLLEIPYGQDTPVSEEALRYEADLADDLGNLVQRTRAMLFRFAEGRI-------PEPVA
3bicA           TGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEA----------GADA
1bs2A           ----------------------------------------------------------------------
1axrA           IAQYAREIWGVEPSRQR-----------------------------------------------------
1cjyB           RPQRGVDLIISF----DFSARPSDSSPPFKELLLAEKWAKMNLPFPKIDPYVFD----------REGLKE
3e3nF           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           IGRYHSDELDADLLLSEGGAIYGAFEGFLGKSDMYPLYSVGSDVWLLPVQRSMDAPSPG----EWKLVFR
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           EHIRDIQLLYKIKNILGIGKECKFNVRNKNHLKNIIIPIFNKYPLTNK-HYDYLYFKDNLL----KDIKY
3c8zA           ----------------------------------------------------------------------
3c98A           -----AKYRAAHVFFTDSSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQM--KNPILE
2e50A           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           PEEIRAKIKKAYCPAGVVE--GNPIMEIAKYFLEYPLTIKRPEKFGGDTVNSYEELESLFKNKELHPDLK
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           LYPRDGVLIGDIHHALTVEGGGHYACD-----------IKTVYRAKKAKMPGYHYVDTKLVI---WNNDK
2c1wB           ----------------------------------------------------------------------
3cglD           LYPRDGVLIGDIHHALTVEGGGHYACDIKTRAKKAALKM-PGYHYVDTKLVIWNNDKE------------
2cfoA           AMGYLAPALANYMTLLGWSPGELFTLDLAAKHFSFERINKAGARFDWDKLNWLNRQ---YIQQLEPEEFL
2cfoB           AMGYLAPALANYMTLLGWSVGELFTLDLAAKHFSFERINKAGARFDWDKLNWLNRQ---YIQQLEPEEFL
1bo6A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
2cybB           PEEVERKIRKAYCPAGVVEPILDIAKYHILPRFGKIVVERDAGDVEYASFEELAED-FKSGQLHPLD-LK
2crqA           ----------------------------------------------------------------------
1cv7A           ITADKQKNGIKAHFK-------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           LFARGGMLIGNNFMALKLEGGGHY-----------LCEFKTTYKAK------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           PEEVERKIRKAYCPAGVVEENPILDIAK-------YHILPRFGKIVVERDAKFGGDVEYAS---------
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           -----PSAIRLGLFSGHYREDRFWSNEVLDEANARLARWRSATALPEAPDATDVIARQYLADD----LDT
3c8zA           -QGVDPSAIRLGLFSGHYREDRFWSNEVLDEANARLARWRSATALPEAPDATDVIAR--VRQYLADDLDT
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           QWAMVRTKHLLDDVSAAYDAYKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPRRRAVQTVLMNI
2bteA           RELYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYR-----------------TA
1abbA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
2csxA           EEYAKIAQESIKNYENYMEKVNFYKAIEEILKFT--SYLNKYVDEKQPWALNKERKKEELQKVLYALVDG
1c8kA           ----------------------------------------------------------------------
2d5bA           GEELAEGTGLAGRLRPLVRELKFHVALEEAMAYV--KALNRYINEKKPW-ELFKKEPEEARAVLYRVVEG
2ct8A           EEYAKIAQESIKNYENYMEKVNFYKAIEEILKFT--SYLNKYVDEKQPWALNKERKKEELQKVLYALVDG
3bicB           ILELAYTLADGLEYSRTGLQAGLTIFAPRLSF-FWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKS
2bvtA           ----------------------------------------------------------------------
2d54A           GEELAEGTGLAGRLRPLVRELKFHVALEEAMAYV--KALNRYINEKKPWELFKK-EPEEARAVLYRVVEG
1a8hA           GEELAEGTGLAGRLRPLVRELKFHVALEEAMA-YVKALNRYINEKKPWELFKK--EPEEARAVLYRVVEG
3bicA           ILELAYTLADGLEYSRTGLQAGLTIFAPRLSFF-WGIGMNFYMEIAKMRHLIEKMFQPKNSKSLLLRAHC
1bs2A           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
1cjyB           CYVFKPDCPTIIHFVLANINFRKYAPGVPRETEEEKEIADFDIFDDPESPFSKRLHDLMHFNTLNNIDVI
3e3nF           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           RDDKGEITGLSVGC-WLARGVEYRRVQ-------------------------------------------
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           YNDLSYYLRPIKPFNTTEDILNKNYFSSWLIGFF-EAKSCFSIYKKTASFEVSNNN--EVLAIKSYL---
3c8zA           ----------------------------------------------------------------------
3c98A           RLAEQIATLCALKEYPAVRYRGEYKDNALLA-QLIQDKLDAYKADDPTMGEG-----------PDKARSQ
2e50A           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           NAVAEELIKILEPIRKRL----------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           EFMKVE---EHEIAVARHHPFY------------------------------------------------
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2cfoA           AELIPLWQGAGYAFDEERDRPWLFDLAQLLQPGLLREAIDQGAVFFIPSVTFD--SEAMAQLGQPQSATI
2cfoB           AELIPLWQGAGYAFDEERDRPWLFDLAQLLQPNTLREAIDQGAVFFIPSVTFD--SEAMAQLGQPQSATI
1bo6A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
2cybB           IAVAKYLNMLLEDARKRL----------------------------------------------------
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           ----------FEELAEDFKSGQLHPLDIAVAKYLNMLL--------------------------------
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           --------------------WDTS---KDYRLLVAEKSVELFIRTIEGAKFRGQWDKKRSILAKEMIPDI
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           PKALAALDGWCTDALSYGGHDTES---PRLVATTVDALLGVD----------------------------
3c8zA           PKALAALDGWCTDALSYGGHDTES---PRLVATTVDALLGVD----------------------------
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LEVLVRVLAPVLSFTTDEVWEHYPQAMRERAGRPTNVQLAGWPKASDFAPAIPADGERVSEDFGVIMGVR
2bteA           IRYYLQMLFPFAPHLAEELWHWFW---------PDSLFEAGWPE----LDEKALEKDVVEVAVQVNGRVR
1abbA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
2csxA           LFVLTHLLYPITPNKMKEALQMLGE--------KEFLKELKPYSKNT-----------------------
1c8kA           ----------------------------------------------------------------------
2d5bA           LRIASILLTPAMPDKMAELRRALGLKEEVR-----LEEAERWGLAEP-----------------------
2ct8A           LFVLTHLLYPITPNKMKEALQMLGE--------KEFLKELKPYSKNT-----------------------
3bicB           LLLRAHCQTSGWSLTEQDPYNNIVRTAIE-----AMAAVFGGTQSLHTNSFDEALGLP--TVKSARIARN
2bvtA           ----------------------------------------------------------------------
2d54A           LRIASILLTPAMPDKMAELRRALGLKEEVR-----LEEAERWGLAEP-----------------------
1a8hA           LRIASILLTPAMPDKMAELRRALGLKEEVR-----LEEAERWGLAEP-----------------------
3bicA           QTTEQDPYNNIVRTAIEAMAAVF--------GGTQSLHTNSFD----EALGLPTVKSARIARNTQIIIQE
1bs2A           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
1cjyB           KEAMVESI--------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c98A           LLILDRGFDPSSPVLHELTFQAMS----------------------------------------------
2e50A           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2cfoA           LAYLLEHLPAEPALTVAMGQQ-------------------------------------------------
2cfoB           LAYLLEHLPAEPALTVAMGQQ-------------------------------------------------
1bo6A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2adyA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2ahiC           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2ahiA           ----------------------------------------------------------------------
2e8gA           QALRYSYIDPEELVDTPQMKDLKEKAKGIIEALGGEDWHHKF----------------------------
3d0aA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3d0aB           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2ac0D           ----------------------------------------------------------------------
2ahiD           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
2ac0A           ----------------------------------------------------------------------
2ataA           ----------------------------------------------------------------------
3d0aC           ----------------------------------------------------------------------
3d07B           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3d0aD           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           EVVTKALEDARGQKVVNKSQEAAVVVTAPRAVLDAVERYDAAVFEELFIVASVSFAEGEELAATVSKTEA
2bteA           GTIHIPKDAPLEVARAEALKVRNVRA--------------------------------------------
1abbA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
1c8kA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
3bicB           TQIIIQEESGIPKVADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQA
2bvtA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3bicA           ESGIPKVADPWGGSYMMECLTNDVYDAALKL-INEIEEMGGMAKAVAEGIPKLRIEECAARRQARIDSGS
1bs2A           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2e50A           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
1b12C           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
1bo6A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3dtiA           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2adyA           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTCPVQAMAIYKQSQHMT
3c5fA           ----------------------------------------------------------------------
2ahiC           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKGTRVRAMAIYKQSQHMT
2bcqA           ----------------------------------------------------------------------
2ahiA           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTCPVRAMAIYKQSQHMT
2e8gA           ----------------------------------------------------------------------
3d0aA           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQPPPGTRVRAMAIYKQSQRMT
2c1qA           ----------------------------------------------------------------------
3d0aB           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTTRVRAMAIYKQSQRMT
1cfrA           ----------------------------------------------------------------------
2ac0D           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTCPVRAMAIYKQSQHMT
2ahiD           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTCPVRAMAIYKQSQHMT
1d2rA           ----------------------------------------------------------------------
2ac0A           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTCPVQAMAIYKQSQHMT
2ataA           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTCPVQAMAIYKQSQHMT
3d0aC           -----SQKTYQGSYFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDTRVRAMAIYKQSQRMT
3d07B           ----PSQKTYQGSGFRLGFLHSGTAKSVTCTYSPALNKMF------CQLAKTCPTRVRAMAIYKQSQHMT
3egbB           ----------------------------------------------------------------------
3d0aD           -----SQKTYQGYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDTRVRAMAIYKQSQRMT
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
3d07A           ---------VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPAL-NKMFCQLAKTTRVRAMAIYKQSQHMT
2cycA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2b29A           ----------------------------------------------------------------------
3ecjB           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           EKCPRCWNHRALGGNANHGSVCERCGDALDAIGFAExx
2bteA           --------------------------------------
1abbA           --------------------------------------
2amvA           --------------------------------------
2csxA           --------------------------------------
1c8kA           --------------------------------------
2d5bA           --------------------------------------
2ct8A           --------------------------------------
3bicB           RIDSGSEVIV----------------------------
2bvtA           --------------------------------------
2d54A           --------------------------------------
1a8hA           --------------------------------------
3bicA           EVIVGVNKYQ----------------------------
1bs2A           --------------------------------------
1axrA           --------------------------------------
1cjyB           --------------------------------------
3e3nF           --------------------------------------
3bjqI           --------------------------------------
2ajgA           --------------------------------------
3bjqF           --------------------------------------
1ei5A           --------------------------------------
2ajgB           --------------------------------------
2ajhB           --------------------------------------
2dlcX           --------------------------------------
3c8zB           --------------------------------------
2aelA           --------------------------------------
2aelB           --------------------------------------
2ab5B           --------------------------------------
3c8zA           --------------------------------------
3c98A           --------------------------------------
2e50A           --------------------------------------
2c1wC           --------------------------------------
2e50B           --------------------------------------
1b12C           --------------------------------------
2ag6A           --------------------------------------
2azoB           --------------------------------------
1a1xA           --------------------------------------
3cglC           --------------------------------------
2c1wB           --------------------------------------
3cglD           --------------------------------------
2cfoA           --------------------------------------
2cfoB           --------------------------------------
1bo6A           --------------------------------------
2aekA           --------------------------------------
2cybB           --------------------------------------
2crqA           --------------------------------------
1cv7A           --------------------------------------
2c1sA           --------------------------------------
3dtiA           --------------------------------------
2arlA           --------------------------------------
3cfiJ           --------------------------------------
3ecjA           --------------------------------------
2azxA           --------------------------------------
2bcrA           --------------------------------------
3ci0I           --------------------------------------
3dl5B           --------------------------------------
2cybA           --------------------------------------
2bcvA           --------------------------------------
2adyA           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
3c5fA           --------------------------------------
2ahiC           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
2bcqA           --------------------------------------
2ahiA           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
2e8gA           --------------------------------------
3d0aA           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
2c1qA           --------------------------------------
3d0aB           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
1cfrA           --------------------------------------
2ac0D           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYLDD--
2ahiD           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
1d2rA           --------------------------------------
2ac0A           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
2ataA           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYLDD--
3d0aC           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
3d07B           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRVEYL----
3egbB           --------------------------------------
3d0aD           EVVRRCPHHERDSDGLAPPQHLIRVEGNLRV-------
2clpI           --------------------------------------
2clpA           --------------------------------------
3d07A           EVVRRCPHHERDSDGLAPPQHLIRV-------------
2cycA           --------------------------------------
1bdgA           --------------------------------------
1b25A           --------------------------------------
2b29A           --------------------------------------
3ecjB           --------------------------------------
2csxA           --------------------------------------
2d5bA           --------------------------------------
2ct8A           --------------------------------------
2d54A           --------------------------------------
1a8hA           --------------------------------------
3c8zB           --------------------------------------
3c8zA           --------------------------------------
2ag6A           --------------------------------------
2cfoB           --------------------------------------