[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55587.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "3cg6B.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "2afiH.bssp"
#ERROR : Can't open dsspfile "1de0A.bssp"
#ERROR : Can't open dsspfile "2cnwF.bssp"
#ERROR : Can't open dsspfile "2afkE.bssp"
#ERROR : Can't open dsspfile "3bn4A.bssp"
#ERROR : Can't open dsspfile "3bn4B.bssp"
#ERROR : Can't open dsspfile "3dn9B.bssp"
#ERROR : Can't open dsspfile "3dncA.bssp"
#ERROR : Can't open dsspfile "2afkH.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2afkG.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2afkF.bssp"
#ERROR : Can't open dsspfile "2afiF.bssp"
#ERROR : Can't open dsspfile "2afiE.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3dn9A.bssp"
#ERROR : Can't open dsspfile "1aa3A.bssp"
#ERROR : Can't open dsspfile "2afiO.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3cgiC.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3e2iA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2cnwE.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2ak3A.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"

## Summary of PDB Search
:352
    9e-47  53%  3cmxA  [x.x.x] PROTEIN RECA
    4e-41  53%  3cmwC  [x.x.x] PROTEIN RECA
    2e-37  51%  3cmvH  [x.x.x] PROTEIN RECA
    6e-37  65%  3cmtD  [x.x.x] PROTEIN RECA
    1e-36  51%  3cmuA  [x.x.x] PROTEIN RECA
    6e-36  55%  3cmvA  [x.x.x] PROTEIN RECA
    7e-35  56%  3cmwA  [x.x.x] PROTEIN RECA
    5e-31  52%  3cmvE  [x.x.x] PROTEIN RECA
    4e-26  50%  3cmvB  [x.x.x] PROTEIN RECA
    5e-24  18%  3cg6B  [x.x.x] GROWTH ARREST AND DNA-DAMAGE-INDUCIBLE 45 GAMMA
    2e-22  20%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    5e-22  13%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    2e-21  20%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    6e-17   9%  2afiH  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-16  10%  1de0A  [c.37.1] NITROGENASE IRON PROTEIN
    4e-15  15%  2cnwF  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-15  10%  2afkE  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-13  11%  3bn4A  [x.x.x] CARBON DIOXIDE-CONCENTRATING MECHANISM PROTEIN
    3e-13  11%  3bn4B  [x.x.x] CARBON DIOXIDE-CONCENTRATING MECHANISM PROTEIN
    8e-13  11%  3dn9B  [x.x.x] CCMK1 C-TERMINAL DELETION MUTANT
    8e-13  12%  3dncA  [x.x.x] CARBON DIOXIDE-CONCENTRATING MECHANISM PROTEIN
    2e-12  11%  2afkH  [x.x.x] NITROGENASE IRON PROTEIN 1
    3e-12  45%  3cmvG  [x.x.x] PROTEIN RECA
    8e-11  11%  2afkG  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-10  36%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    1e-10  10%  2afkF  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-10  10%  2afiF  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-09   9%  2afiE  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-08  49%  3cmvC  [x.x.x] PROTEIN RECA
    1e-08  11%  3dn9A  [x.x.x] CCMK1 C-TERMINAL DELETION MUTANT
    5e-08  45%  1aa3A  [x.x.x] RECA
    5e-08  17%  2afiO  [x.x.x] NITROGENASE IRON PROTEIN 1
    3e-06  21%  1e2jB  [c.37.1] THYMIDINE KINASE
    3e-06  16%  1e2kB  [c.37.1] THYMIDINE KINASE
    5e-06  18%  1e2hA  [c.37.1] THYMIDINE KINASE
    8e-06  14%  1e2nA  [c.37.1] THYMIDINE KINASE
    2e-05  14%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-05  20%  1e2mA  [c.37.1] THYMIDINE KINASE
    4e-05  14%  1e2nB  [c.37.1] THYMIDINE KINASE
    5e-05  21%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    8e-05  18%  3cgiC  [x.x.x] PROPANEDIOL UTILIZATION PROTEIN PDUU
    1e-04  18%  1e2jA  [c.37.1] THYMIDINE KINASE
    1e-04  12%  3e2iA  [x.x.x] THYMIDINE KINASE
    2e-04  13%  1e2lB  [c.37.1] THYMIDINE KINASE
    2e-04  12%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-04  24%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    3e-04  15%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-04  21%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-04  15%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-04  26%  1e2iB  [c.37.1] THYMIDINE KINASE
    4e-04  14%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    5e-04  22%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    5e-04  34%  2cnwE  [x.x.x] CELL DIVISION PROTEIN FTSY
    6e-04  17%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    6e-04  23%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    7e-04  28%  2ak3A  [c.37.1 - g.41.2] ADENYLATE KINASE ISOENZYME-3
    7e-04  17%  1e0jA  [c.37.1] DNA HELICASE
    7e-04   8%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    8e-04  27%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    0.001  14%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
:352

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESS
3cmxA           IDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET-ISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmwC           IDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETI-STGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvH           ----KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET-ISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmtD           IDENKQKALAAALGQIEKQFGKGSIMRLGEDRSM-DVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmuA           IDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVE-TISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvA           ----KQKALAAALGQIEKQFGKGSIMRLGEDRSMD-VETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmwA           IDENKQKALAAALGQIEKQFGKGSIMRLGEDRSM-DVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvE           ----KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET-ISTGSLSLDIALGAGGLPMGRIVEIYGPESS
3cmvB           ----KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSL-DIALGAGGLPMGRIVEIYGPESS
3cg6B           ------------------------------------------------------------------MQG-
3dvlD           ---------------------------------------VSSGVVRLDEMCG-GGFFKDSIILATGATGT
3bs4A           ---------------------------------------LSWEIEELDREIG-KIKKHSLILIHEEDASS
3dvlC           ---------------------------------------VSSGVVRLDEMCG-GGFFKDSIILATGATGT
2afiH           -----------------------------------------------------------RQCAIYGKGGI
1de0A           -----------------------------------------------------------RQCAIYGKGGI
2cnwF           ----------------------------------------------LVGMLEPPVEPKGRVVLVVGVNGV
2afkE           -----------------------------------------------------------RQCAIYGKGGI
3bn4A           ----------------------------------------------------------------------
3bn4B           ----------------------------------------------------------------------
3dn9B           ----------------------------------------------------------------------
3dncA           ----------------------------------------------------------------------
2afkH           -----------------------------------------------------------RQCAIYGKGGI
3cmvG           ----KQKALAAALGQIEKQFGKGSIMRLGEDRSM-DVETISTGSLSLDIALGAGGLPMGRIVEIYGPESS
2afkG           -----------------------------------------------------------RQCAIYGKGGI
2cvfA           --------------------------------------MLSTGTKSLDSLLG-GGFAPGVLTQVYGPYAS
2afkF           -----------------------------------------------------------RQCAIYGKGGI
2afiF           -----------------------------------------------------------RQCAIYGKGGI
2afiE           ----------------------------------------------------------AMRQCAIYGKGI
3cmvC           ----------------------------------------------LDIALGAGGLPMGRIVEIYGPESS
3dn9A           ----------------------------------------------------------------------
1aa3A           ----------------------------------------------------------------------
2afiO           -----------------------------------------------------------RQCAIYGKGGI
1e2jB           -------------------------------------------------------MPTLLRVYIDGPHGM
1e2kB           --------------------------------------------------------PTLLRVYIDGPHGM
1e2hA           --------------------------------------------------------PTLLRVYIDGPHGM
1e2nA           --------------------------------------------------------PTLLRVYIDGPHGM
1e2hB           -------------------------------------------------------MPTLLRVYIDGPHGM
1e2mA           --------------------------------------------------------PTLLRVYIDGPHGM
1e2nB           --------------------------------------------------------PTLLRVYIDGPHGM
1cr1A           -----------------------------------SVGLLFSGCTGINDKTL--GARGGEVIMVTSGSGM
3cgiC           --------------------------------------------------------TTDRMIQEYVP---
1e2jA           --------------------------------------------------------PTLLRVYIDGPHGM
3e2iA           ----------------------------------------------------------GWIECITGS-FS
1e2lB           --------------------------------------------------------PTLLRVYIDGPHGM
1e2mB           --------------------------------------------------------PTLLRVYIDGPHGM
2dr3F           ---------------------------------------VKTGIPGVDEILH-GGIPERNVVLLSGGPGT
1cr2A           -----------------------------------SVGLLFSGCTGINDKTL--GARGGEVIMVTSGSGM
3dm9B           ------------------------------------------------------RKAEKPYVIFVGFNGS
1e9sL           --------------------------------------------------------AEPRHLLVNGATGT
1e2iB           --------------------------------------------------------PTLLRVYIDGPHGM
2a30A           ---------------------------------------------------------RIKKISIEGNIAA
2ax4A           -----------------------------------------------GQVVGTRGGFRGCTVWLTGLSGA
2cnwE           --------------------------------------------------------PKGRVVLVVGVNGV
2bwjA           ------------------------------------------------------DLRKCKIIFIIGGPGS
2dr3E           ---------------------------------------VKTGIPGVDEILHGG-IPERNVVLLSGGPGT
2ak3A           -----------------------------------------------------GASARLLRAAIMGAPGS
1e0jA           -------------------------------------------------------ARGGEVIMVTSGSGM
3czpB           -------------------------------------------------------RQHSLVAVFEGNDAA
2c61B           -------------------------------------------------------LVRGQKLPIFSASGL
2dwoA           -------------------------------------------------------PNSPTVIVMVGLPAR


                         .         .         *         .         .         .         .:140
query           GKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXX
3cmxA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3cmwC           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3cmvH           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3cmtD           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3cmuA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3cmvA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3cmwA           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3cmvE           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA---
3cmvB           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARS-----
3cg6B           -AGKALHELLLSAQRQGCLTAGVESAKVLNVDPDN---VTFCVLAADEEDEGDIALQIHFTLIQAFCCEN
3dvlD           GKTLLVSRFVENACANKERAILFAYEESRAQLNAYSWGMDFEEMERPESAGLEDHLQIIKSEINDF----
3bs4A           RGKDILFYILSRKLKSDNLVGMFSISYPLQLIILSRFGVDVIKYL------ENHRLAIVDTFGSFH----
3dvlC           GKTLLVSRFVENACANKERAILFAYEESRAQLLAYSWGMDFEEMEIVCAYPESAGLEIIKSEINDFKPAR
2afiH           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGV
1de0A           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKA-GYGG
2cnwF           GKTTTIAKLGRYYQNLGKKVMFCAGDTAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGY
2afkE           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAG-YGG
3bn4A           -------------------------------------------VGMIETLGFPAVVEAADSMVKAARVTL
3bn4B           -------------------------------------------VGMIETLGFPAVVEAADSMVKAARVTL
3dn9B           -------------------------------------------VGMIETLGFPAVVEAADSMVKAARVTL
3dncA           -------------------------------------------VGMIETRGFPAVVEAADSMVKAARVTL
2afkH           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGV
3cmvG           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
2afkG           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGV
2cvfA           GKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETR--------------------------------
2afkF           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGV
2afiF           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGV
2afiE           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGV
3cmvC           GKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3dn9A           -------------------------------------------VGMIETLGFPAVVEAADSMVKAARVTL
1aa3A           ----------------------------------------------------------------------
2afiO           GKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAG----
1e2jB           GKTTTTQLLVALGSRDDIVYVPEPMTY-------------------------------------------
1e2kB           GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAIANIYTTQHRLDQGEISAGDAAVVMTSAQITMG----
1e2hA           GKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIY----------------------------------
1e2nA           GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQ---------------------
1e2hB           GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQ--GEISAGDAAVVMTSAQITM
1e2mA           GKTTTTQLLRDDIVYVPEPMTYWRVLGASET---------------------------------------
1e2nB           GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQ---------------------
1cr1A           GKSTFVRQQAQWGTAMGKKVGLAMLEESVEETA-------------------------------------
3cgiC           GKQVTLAHLIANPGKD------LFKKLGLQDAVSA--------IGILTITPSEASIIACDIATKSGAVEI
1e2jA           GKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIY----------------------------------
3e2iA           GKSEELIRRLRRGIYAKQKVVVFKPASHNGNAIEAINISKASEITHDLTNVDVIGIDEVQFF--------
1e2lB           GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIFTTQHRLDQGEISAGDAAVVM---------
1e2mB           GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAA------------
2dr3F           GKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGW-----------------------------
1cr2A           GKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQ------
3dm9B           GKTTTIAKLANWLKNHGFSVVIAASD--------------------------------------------
1e9sL           GKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKD--------------------------------
1e2iB           GKTTTTQLLVALGSRDDIVY--------------------------------------------------
2a30A           GKSTFVNILKQLCEDWEVVPEP------------------------------------------------
2ax4A           GKTTISFALEEYLVSHAIPCYSLDGDN-------------------------------------------
2cnwE           GKTTTIAKLGRYYQNLGKKVMFCAGDT-------------------------------------------
2bwjA           GKGTQCEKLVEKYGFTHLST--------------------------------------------------
2dr3E           GKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQF-------------------------------
2ak3A           GKGTVSSRITKH----------------------------------------------------------
1e0jA           GKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLI--------------------------------
3czpB           GKGGAIRRVTDALDPRQYHIVP------------------------------------------------
2c61B           PHNEIALQIARQASVPGSESAF------------------------------------------------
2dwoA           GKTYISKKLTRYLNWIGVPT--------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMFGNPETTT
3cmxA           IVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmwC           IVVDSVAALTPKAE----------GLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMK------NPETTT
3cmvH           IVVDSVA--------------ALTPLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNAL-------KFYA
3cmtD           IVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmuA           IVVDSVAALTPK-------AEIEMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRNPE--------TTT
3cmvA           IVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmwA           IVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTT
3cmvE           --------------VDVIVVDSVAPLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNAL-------KFYA
3cmvB           ------------GAVDVIVVDSVTPLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIR
3cg6B           DIDIVRVG--DVQRLAAIVGDLHCILISNPKDPALEKLSLFCEESNDWVPSIT-----------------
3dvlD           ---------KPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQFMGA---------
3bs4A           ------------GIMPGVWYLE----GMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRELYGFAISMSGY
3dvlC           IAIDS-------------LSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQFMGA---------
2afiH           KCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMA
1de0A           VKCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLGDVVCGGWAMPIRENKAQEIYIVCS
2cnwF           DLLFVDTAGRLHTKHNLMEELKKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAK
2afkE           VKCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCS
3bn4A           VGYEKIGSGRVTVIVRGDVSEVQASVTA-GIENIRRVNGGEVLSNHI-----------------------
3bn4B           VGYEKIGSGRVTVIVRGDVSEVQASVTA-GIENIRRVNGGEVLSNHI-----------------------
3dn9B           VGYEKIGSGRVTVIVRGDVSEVQASVTA-GIENIRRVNGGEVLSNHI-----------------------
3dncA           VGYEKIGSGRVTVIVRGDVSEVQASVSA-GIEAANRVNGGEVLSTHI-----------------------
2afkH           KCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLDFVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMA
3cmvG           IVVDSVAALTPKAEIEGLAARMMSQAMRKLAGNL-KQSN-------TLLIFINQGGNALKFY---ASVRL
2afkG           KCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLDFVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMA
2cvfA           ----------------------------------------------------------------------
2afkF           KCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLDFVVLGDVVCGGFAMPIRENKAQEIYVCSGEMMA
2afiF           KCVESGGPEPGVGCAGRGVIT--AINFLEEEGAYEDDLDFVFYDVLGDVVCGGFAMPIRIYIVCSGEMMA
2afiE           KCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLDFVFYDVLGDVVCGGFAMPIAQEIYIVCSGEMMA
3cmvC           IVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIR
3dn9A           VGYEKIGSGRVTVIVRGDVSEVQASVTA-GIENIRRVNGGEVLSNHIIAR--------------------
1aa3A           ----------------------------------------------------------------------
2afiO           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
1e2hB           GMPYAVTDAVLAPHIGGEPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALI-----------
1e2mA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cgiC           GFLDRFTGAV---VLTGDVSAVEYALKQVT--RTLGEMMQFTTCSIT-----------------------
1e2jA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2cnwE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVE
3cmxA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmwC           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvH           SVRLDIRRIGAVKEGE---------NVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmtD           GGNALKF---------------------------------------------------------------
3cmuA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmwA           GGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvE           SVRLDI---------RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cmvB           RIGAVKEGE----------------NVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
3cg6B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3bs4A           LEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRSSLGENGIKR---E
3dvlC           ----------------------------------------------------------------------
2afiH           MYAANNISKGIVKYANSGSVRL----GGLICNSRNTDREDELIIALANKLGTQMIHFVPRDNVVQRAE--
1de0A           GEMMAMYAANNISKGIVKYANSGSVRLGG-----LICNSRNTDREDELIIALANKLGTQMIHFVPDNVVQ
2cnwF           GGVLIPI---------------------------------------------------------------
2afkE           GEMMAMYAANNISKGIVKYANSGSVRLGG-----LICNSRNTDREDELIIALANKLGTQMIHFVPDNVVQ
3bn4A           ----------------------------------------------------------------------
3bn4B           ----------------------------------------------------------------------
3dn9B           ----------------------------------------------------------------------
3dncA           ----------------------------------------------------------------------
2afkH           MYAANNI---------------------------------------------------------------
3cmvG           DIRRI-------------GAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVK
2afkG           MYAANNI---------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2afkF           MYAANNI---------------------------------------------------------------
2afiF           MYAANNI---------------------------------------------------------------
2afiE           MYAANNI---------------------------------------------------------------
3cmvC           RIG-AVKEGENVVGSETRVKVVKNKIA---------------APFKQAEFQILYGEGINFYGELVDLGVK
3dn9A           ----------------------------------------------------------------------
1aa3A           ---------------------------------------------------------INFYGELVDLGVK
2afiO           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cgiC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2cnwE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAK
3cmxA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSAIDEN------------
3cmwC           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmvH           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmtD           ----------------------------------------------------------------------
3cmuA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmvA           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmwA           EKLIEKAGAWYSYKGE------------------------------------------------------
3cmvE           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cmvB           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
3cg6B           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3bs4A           LLVIKTPKVRFEY---------------------------------------------------------
3dvlC           ----------------------------------------------------------------------
2afiH           ---IRRMTVIEYDPKAKQADEYRALARKVVDNKLLVIPNPITMDELEE----------------------
1de0A           RAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLVIPNPITMDELEEL---------------------
2cnwF           ----------------------------------------------------------------------
2afkE           RAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLVIPNPITMDELEEL---------------------
3bn4A           ----------------------------------------------------------------------
3bn4B           ----------------------------------------------------------------------
3dn9B           ----------------------------------------------------------------------
3dncA           ----------------------------------------------------------------------
2afkH           ----------------------------------------------------------------------
3cmvG           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-----LLLKQKALAAALGQIEKQFG
2afkG           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2afkF           ----------------------------------------------------------------------
2afiF           ----------------------------------------------------------------------
2afiE           ----------------------------------------------------------------------
3cmvC           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-----LLLKQKALAAALGQIEKQFG
3dn9A           ----------------------------------------------------------------------
1aa3A           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRE-------------------------
2afiO           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cgiC           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2cnwE           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KK
3cmxA           --
3cmwC           --
3cmvH           --
3cmtD           --
3cmuA           --
3cmvA           --
3cmwA           --
3cmvE           --
3cmvB           --
3cg6B           --
3dvlD           --
3bs4A           --
3dvlC           --
2afiH           --
1de0A           --
2cnwF           --
2afkE           --
3bn4A           --
3bn4B           --
3dn9B           --
3dncA           --
2afkH           --
3cmvG           K-
2afkG           --
2cvfA           --
2afkF           --
2afiF           --
2afiE           --
3cmvC           KG
3dn9A           --
1aa3A           --
2afiO           --
1e2jB           --
1e2kB           --
1e2hA           --
1e2nA           --
1e2hB           --
1e2mA           --
1e2nB           --
1cr1A           --
3cgiC           --
1e2jA           --
3e2iA           --
1e2lB           --
1e2mB           --
2dr3F           --
1cr2A           --
3dm9B           --
1e9sL           --
1e2iB           --
2a30A           --
2ax4A           --
2cnwE           --
2bwjA           --
2dr3E           --
2ak3A           --
1e0jA           --
3czpB           --
2c61B           --
2dwoA           --