[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55591.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d1nN.bssp"
#ERROR : Can't open dsspfile "2ao9G.bssp"
#ERROR : Can't open dsspfile "3b7hA.bssp"
#ERROR : Can't open dsspfile "3clcA.bssp"
#ERROR : Can't open dsspfile "2ao9D.bssp"
#ERROR : Can't open dsspfile "3clcB.bssp"
#ERROR : Can't open dsspfile "1b0nA.bssp"
#ERROR : Can't open dsspfile "3croL.bssp"
#ERROR : Can't open dsspfile "3croR.bssp"
#ERROR : Can't open dsspfile "3bdnA.bssp"
#ERROR : Can't open dsspfile "3dnvB.bssp"
#ERROR : Can't open dsspfile "2a6cA.bssp"
#ERROR : Can't open dsspfile "2croA.bssp"
#ERROR : Can't open dsspfile "2ef8B.bssp"
#ERROR : Can't open dsspfile "2ef8A.bssp"
#ERROR : Can't open dsspfile "2aw6A.bssp"
#ERROR : Can't open dsspfile "2b5aA.bssp"
#ERROR : Can't open dsspfile "2bnnB.bssp"
#ERROR : Can't open dsspfile "2bnmA.bssp"
#ERROR : Can't open dsspfile "2axuC.bssp"
#ERROR : Can't open dsspfile "2aw6B.bssp"
#ERROR : Can't open dsspfile "3d1nP.bssp"

## Summary of PDB Search
:378
    3e-06   7%  3d1nN  [x.x.x] POU DOMAIN, CLASS 6, TRANSCRIPTION FACTOR 1
    9e-06  13%  2ao9G  [x.x.x] PHAGE PROTEIN
    9e-06  11%  3b7hA  [x.x.x] PROPHAGE LP1 PROTEIN 11
    1e-05  13%  3clcA  [x.x.x] REGULATORY PROTEIN
    1e-05  13%  2ao9D  [x.x.x] PHAGE PROTEIN
    2e-05  13%  3clcB  [x.x.x] REGULATORY PROTEIN
    3e-05  15%  1b0nA  [a.35.1 - a.34.1] PROTEIN (SINR PROTEIN)
    4e-05  14%  3croL  [a.35.1] PROTEIN (434 CRO)
    4e-05  14%  3croR  [a.35.1] PROTEIN (434 CRO)
    6e-05  20%  3bdnA  [x.x.x] LAMBDA REPRESSOR
    1e-04  12%  3dnvB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR HIPB
    2e-04  11%  2a6cA  [x.x.x] HELIX-TURN-HELIX MOTIF
    2e-04  14%  2croA  [x.x.x] REGULATORY PROTEIN CRO
    2e-04  17%  2ef8B  [x.x.x] PUTATIVE TRANSCRIPTION FACTOR
    3e-04  17%  2ef8A  [x.x.x] PUTATIVE TRANSCRIPTION FACTOR
    3e-04  13%  2aw6A  [x.x.x] PRGX
    3e-04  18%  2b5aA  [x.x.x] C.BCLI
    3e-04  31%  2bnnB  [x.x.x] EPOXIDASE
    4e-04  31%  2bnmA  [x.x.x] EPOXIDASE
    5e-04  17%  2axuC  [x.x.x] PRGX
    6e-04  11%  2aw6B  [x.x.x] PRGX
    9e-04   8%  3d1nP  [x.x.x] POU DOMAIN, CLASS 6, TRANSCRIPTION FACTOR 1
:378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTFGTILREARERKGYDLATAARRLRIRPDILRAIEEDDFSRMPPRGYARNMVNAYARLVGLNPTEMTRM
3d1nN           REFAKNFKIRRLSLGLTQTQVGQATATEGPAYSQSAISRFEKLDIT---PKSAQKLKPVLEKWLNEAELR
2ao9G           AAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDFIAF-----KSEVADSFLAEKREQV----
3b7hA           EFVSEHLMELITQQNLTINRVATLAGLNQSTVNAMFEGRSKRPTI-----TTIRKVCGTLGISVHD----
3clcA           SKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNS--RNLTIKSLE----LIMKGLEVSDVVFFEM
2ao9D           AAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFK-----SEVADSFLAEKREQV----
3clcB           SKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNS--RNLTIKSLE----LIMKGLEVSDVVFFEM
1b0nA           --IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQ-----FLEKVSAVLDVSVHTLLDE
3croL           -TLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAG---VTKRPR----FLFEIAMALNCDPVW----
3croR           -TLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAG---VTKRPR----FLFEIAMALNCDPVW----
3bdnA           RRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALF---------NG--INALNAY--------------
3dnvB           -QLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNP--DNTTLTTFF----KILQSLELSMTL----
2a6cA           SQLLIVLQEHLRNSGLTQFKAAELLGVTQPRVSDLRGKI--DLFSLESLIDITSIGLKV-----------
2croA           -TLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAG---VTKRPR----FLFEIAMALNCDPVW----
2ef8B           YRLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIE----------------------------------
2ef8A           YRLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIE----------------------------------
2aw6A           FKIGSVLKQIRQELNYHQIDLYSG-IMSKSVYIKVEADS--RPISVEELSKFSERL--------------
2b5aA           RKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGD--RNISLINIH----KICAALDIPASTFFRK
2bnnB           TGFAELLKDRREQVKMDHAALASLLGETPETVAAWE----------------------------------
2bnmA           -GFAELLKDRREQVKMDHAALASLLGETPETVAAWE----------------------------------
2axuC           --IGSVLKQIRQELNYHQIDLYS--GISKSVYIKVEADS------RPISVEELSKFSERLGVNFFEILNR
2aw6B           FKIGSVLKQIRQELNYHQIDLYSG-IMSKSVYIKVEADSR--PISVEELSKFSERL--------------
3d1nP           -EFAKNFKIRRLSLGLTQTQVGQATATEGPAYSQSAISRFEKLDIT---PKSAQKLKPVLEKWLNE----


                         .         .         *         .         .         .         .:140
query           YLDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d1nN           NQEG------------------------------------------------------------------
2ao9G           ----------------------------------------------------------------------
3b7hA           ----------------------------------------------------------------------
3clcA           LIKE------------------------------------------------------------------
2ao9D           ----------------------------------------------------------------------
3clcB           LIKE------------------------------------------------------------------
1b0nA           KHET------------------------------------------------------------------
3croL           ----------------------------------------------------------------------
3croR           ----------------------------------------------------------------------
3bdnA           ----------------------------------------------------------------------
3dnvB           ----------------------------------------------------------------------
2a6cA           ----------------------------------------------------------------------
2croA           ----------------------------------------------------------------------
2ef8B           ----------------------------------------------------------------------
2ef8A           ----------------------------------------------------------------------
2aw6A           ----------------------------------------------------------------------
2b5aA           MEEE------------------------------------------------------------------
2bnnB           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2axuC           AGNS------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3d1nP           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d1nN           ----------------------------------------------------------------------
2ao9G           ----------------------------------------------------------------------
3b7hA           ----------------------------------------------------------------------
3clcA           ----------------------------------------------------------------------
2ao9D           ----------------------------------------------------------------------
3clcB           ----------------------------------------------------------------------
1b0nA           ----------------------------------------------------------------------
3croL           ----------------------------------------------------------------------
3croR           ----------------------------------------------------------------------
3bdnA           ----------------------------------------------------------------------
3dnvB           ----------------------------------------------------------------------
2a6cA           ----------------------------------------------------------------------
2croA           ----------------------------------------------------------------------
2ef8B           ----------------------------------------------------------------------
2ef8A           ----------------------------------------------------------------------
2aw6A           ----------------------------------------------------------------------
2b5aA           ----------------------------------------------------------------------
2bnnB           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2axuC           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3d1nP           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d1nN           ----------------------------------------------------------------------
2ao9G           ----------------------------------------------------------------------
3b7hA           ----------------------------------------------------------------------
3clcA           ----------------------------------------------------------------------
2ao9D           ----------------------------------------------------------------------
3clcB           ----------------------------------------------------------------------
1b0nA           ----------------------------------------------------------------------
3croL           ----------------------------------------------------------------------
3croR           ----------------------------------------------------------------------
3bdnA           ----------------------------------------------------------------------
3dnvB           ----------------------------------------------------------------------
2a6cA           ----------------------------------------------------------------------
2croA           ----------------------------------------------------------------------
2ef8B           ----------------------------------------------------------------------
2ef8A           ----------------------------------------------------------------------
2aw6A           ----------------------------------------------------------------------
2b5aA           ----------------------------------------------------------------------
2bnnB           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2axuC           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3d1nP           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d1nN           ----------------------------------------------------------------------
2ao9G           ----------------------------------------------------------------------
3b7hA           ----------------------------------------------------------------------
3clcA           ----------------------------------------------------------------------
2ao9D           ----------------------------------------------------------------------
3clcB           ----------------------------------------------------------------------
1b0nA           ----------------------------------------------------------------------
3croL           ----------------------------------------------------------------------
3croR           ----------------------------------------------------------------------
3bdnA           ----------------------------------------------------------------------
3dnvB           ----------------------------------------------------------------------
2a6cA           ----------------------------------------------------------------------
2croA           ----------------------------------------------------------------------
2ef8B           ----------------------------------------------------------------------
2ef8A           ----------------------------------------------------------------------
2aw6A           ----------------------------------------------------------------------
2b5aA           ----------------------------------------------------------------------
2bnnB           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2axuC           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3d1nP           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d1nN           ----------------------------
2ao9G           ----------------------------
3b7hA           ----------------------------
3clcA           ----------------------------
2ao9D           ----------------------------
3clcB           ----------------------------
1b0nA           ----------------------------
3croL           ----------------------------
3croR           ----------------------------
3bdnA           ----------------------------
3dnvB           ----------------------------
2a6cA           ----------------------------
2croA           ----------------------------
2ef8B           ----------------------------
2ef8A           ----------------------------
2aw6A           ----------------------------
2b5aA           ----------------------------
2bnnB           ----------------------------
2bnmA           ----------------------------
2axuC           ----------------------------
2aw6B           ----------------------------
3d1nP           ----------------------------