[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55743.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c3aA.bssp"
#ERROR : Can't open dsspfile "3c3aB.bssp"
#ERROR : Can't open dsspfile "1d0nA.bssp"
#ERROR : Can't open dsspfile "16pkA.bssp"
#ERROR : Can't open dsspfile "3c39B.bssp"
#ERROR : Can't open dsspfile "3c39A.bssp"
#ERROR : Can't open dsspfile "3c3bB.bssp"
#ERROR : Can't open dsspfile "2cunA.bssp"
#ERROR : Can't open dsspfile "3c3bA.bssp"
#ERROR : Can't open dsspfile "3d01D.bssp"
#ERROR : Can't open dsspfile "3d01B.bssp"
#ERROR : Can't open dsspfile "2e28A.bssp"
#ERROR : Can't open dsspfile "3d01G.bssp"
#ERROR : Can't open dsspfile "3d01K.bssp"
#ERROR : Can't open dsspfile "3d01L.bssp"
#ERROR : Can't open dsspfile "3d01I.bssp"
#ERROR : Can't open dsspfile "3d01E.bssp"

## Summary of PDB Search
:394
    1e-89  47%  3c3aA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-89  47%  3c3aB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    2e-73  13%  1d0nA  [d.109.1 - d.109.1 - d.109.1 - d.109.1 - d.109.1 - d.109.1]
    4e-72  45%  16pkA  [c.86.1 (13pkA)] 3-PHOSPHOGLYCERATE KINASE
    1e-71  48%  3c39B  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    6e-70  47%  3c39A  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    8e-70  47%  3c3bB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-63  31%  2cunA  [x.x.x] PHOSPHOGLYCERATE KINASE
    2e-53  47%  3c3bA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-15  10%  3d01D  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-12  10%  3d01B  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-11  18%  2e28A  [x.x.x] PYRUVATE KINASE
    6e-11   8%  3d01G  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-10  12%  3d01K  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-07  12%  3d01L  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-06  12%  3d01I  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  11%  3d01E  [x.x.x] UNCHARACTERIZED PROTEIN
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAEIKTIDELDARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMSHLGRPAGEGFE
3c3aA           LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3c3aB           LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
1d0nA           AMAAQHGMDDDGTGQKQIWRVSNKVPVDPATYGQFYGGDSYIILYNYRHGSRQGQIIYNWQGAQSTQ--D
16pkA           ----KSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGRPKGIGFQ
3c39B           LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3c39A           LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3c3bB           LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
2cunA           ---MFRLEDFNFHNKTVFLRVDLNSPMKDGKIISDARFKAVLPTIRYLIESGAKVVIGTHQGKPYSEDYT
3c3bA           LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPMP
3d01D           ----------------------------------ENLYFQGSDVIEGR---------LKELGFTLPVAN-
3d01B           -------------------------------------------LYFQGSDVIEGRLKELGFTLPAA----
2e28A           -------------------------------MKRKTKIVSTIDKLVQLMEAGMNVA---RLNFSHGD-HE
3d01G           ------------------------------------------------------SDVIEGRLKELGFTLP
3d01K           ---------------------------------------------------------IEGRLKELGF-TL
3d01L           ----------------------------------------------------------------------
3d01I           ----------------------------------------------------------------------
3d01E           ---------------------------------------------------------IEGRLKELGFTLP


                         .         .         *         .         .         .         .:140
query           ESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENLRFDKREKKNDPAFCEELAALG
3c3aA           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHKAEPAKIEAFRASLSKLG
3c3aB           DKYSLEPVAVELKSLLGKDVLFLKDCVK-----ACANPAAGSVILLENLRFVKAEPAKIEAFRASLSKLG
1d0nA           EVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIVYKGGTSREGGQTAPAIPKAGALNSN
16pkA           QKATLKPVAKRLSELLLRPVTFAPDCLN--AADVVSKMSPGDVVLLENVRFYKEEGSKKEAMAKILASYG
3c39B           DKYSLEPVAVELKSLLGKDVLFLKDEKA------CANPAAGSVILLENLRFHVEEEGKGKAFRASLSKLG
3c39A           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEKKAEPAFRASLSKLG
3c3bB           DKYSLEPVAVELKSLLGKDVLFLKDCVEK----ACANPAAGSVILLENLRFHVEEPAKIEAFRASLSKLG
2cunA           TTEEHA---RVLSELLDQHVEYIEDIFGRYAREKIKELKSGEVAILENVKNKPIEECEKTFLVKKLSKVI
3c3bA           DKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHKAEPAKIEAFRASLSKLG
3d01D           --YVPFTISGNLLPESGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAAVASVPEFVEQHLVINGAS
3d01B           -NYVPFTISGNLLPESGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAAVASVPEFVEQHLVINGAS
2e28A           EHGRRIANIREAAKRTGRTVAILLDTKGPEIRTHNIELKEGSKLVISMSEVLGTPEKTYPSLIDDVSVGA
3d01G           ANYVPFTISGNLLYVSGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAAVASVPEFVEQHLVINGAS
3d01K           PNYVPFTISGNLLYVSGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAAVASVPEFVEQHLVINGAS
3d01L           ----------------GKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAAVASVPEFVEQHLVINGAS
3d01I           ----------------GKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAAVASVPEFVEQHLVINGAS
3d01E           ANYVPFTISGNLLYVSGKIAVTGLVGRDVDVASAQRAAELCAVNILAQVKAAVASVPEFVEQHLVINGAS


                         +         .         .         .         .         *         .:210
query           EAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVATLSGMLEEPRRPFTAILGGSKVSDKIKVIDAL
3c3aA           DVYVNDAFGTAHRAHSSMVGVNLP-QKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3c3aB           DVYVNDAFGTAHRAHSSMVGV-NLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
1d0nA           DAFVLKTPSAAYLWVGAGASEAKTGAQELLRVLRAQPVQVAEGSEPDSFWEALGGKATYRTSPRLKDKKM
16pkA           DVYISDAFGTAHRDSATMTGIPKILGNGAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLLDNM
3c39B           DVYVNDAFGTAHRAHSSMVGVNL-PQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3c39A           DVYVNDAFGTAHRAHSSMVGV-NLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3c3bB           DVYVNDAFGTAHRAHSSMVGV-NLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
2cunA           DYVVNDAFATAHRSQPSLVGFARIKPMIMGFLMEKEIEALMRAYYSKDSPKIYVLGGAKVEDSLKVVENV
3c3bA           DVYVNDAFGTAHRAHSSMVGV-NLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNM
3d01D           NLI-ATVLGEPGRHARAAVGASLP----FNASVEIDA---------------------------------
3d01B           NLI-ATVLGEPGRHARAAVGASLP----FNASVEIDA---------------------------------
2e28A           KILLDDG-LISLEVNAVDKQAGEIVT--------------------------------------------
3d01G           NLIA-TVLGEPGRHARAAVGASLP----FNASVEIDA---------------------------------
3d01K           NLI-ATVLGEPGRH-ARAAVGASLPFNAS-----------------------------------------
3d01L           NLI-ATVLGEPGRHA-RAAVGASLPF---NASVEIDA---------------------------------
3d01I           NLIA-TVLGEPGRHA-RAAVGASLPF---NASVEIDA---------------------------------
3d01E           NLI-ATVLGEPGRHA-RAAVGASLPF--------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDKCDTLIIGGGMCFTFLLAQGKAVGTSLKEEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAET
3c3aA           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3c3aB           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
1d0nA           DAHPPRLFACSNKIGRFVIEEPGEFMQEDLATDWVGKD----SQDEEKTEALTSAKRYIDTDPAHRDRRT
16pkA           LQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHTEFKAVDSP
3c39B           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3c39A           LDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3c3bB           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
2cunA           LRREDLVLTGGLVANVFTLAKGFDLGRKNVEFMKKKGLLDYVKHADEFYPYIRTPVDFAVDYKGERVEID
3c3bA           LDKVNEMIIGGGMAFTFLVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKT
3d01D           ----------------------------------------------------------------------
3d01B           ----------------------------------------------------------------------
2e28A           ----------------------------------------------------------------------
3d01G           ----------------------------------------------------------------------
3d01K           ----------------------------------------------------------------------
3d01L           ----------------------------------------------------------------------
3d01I           ----------------------------------------------------------------------
3d01E           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LTVSVDGIPGDMMGLDIGPETAKLYADAVAQAKTVFWNGPMGVFEMKAFXXXXXXXXXXXXXXXXXXXII
3c3aA           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFGTKALMDEVVKATSRGCITII
3c3aB           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDE----------V
1d0nA           PITVVGFEPPSFVGWFLGWDDSYWSVDPLDRALAELA---------------------------------
16pkA           LITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEYSKGTFAIAKAMGRGTHEHGLMSII
3c39B           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCII
3c39A           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCIT
3c3bB           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEV----------
2cunA           LLSENRGLLHQYQIMDIGKRTAEKYREILMKARIIVANGPMGVFEREEF-AIGTVEVFKAIADSPAFSVL
3c3bA           GQATVSGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCI-
3d01D           ----------------------------------------------------------------------
3d01B           ----------------------------------------------------------------------
2e28A           ----------------------------------------------------------------------
3d01G           ----------------------------------------------------------------------
3d01K           ----------------------------------------------------------------------
3d01L           ----------------------------------------------------------------------
3d01I           ----------------------------------------------------------------------
3d01E           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GGGDSVAAVNKFDLAEQMTFISTGGGASMELVQGEALPGVEALK
3c3aA           GGWNT---------EDKVSHVSTGGGASLELLEGKVLPGVDAL-
3c3aB           VKATSRGCITIIGGEDKVSHVSTGGGASLELLEGKVLPGVDAL-
1d0nA           --------------------------------------------
16pkA           GGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVL-
3c39B           IGGD------------KVSHVSTGGGASLELLEGKVLPGVDALS
3c39A           -----------IIGGDKVSHVSTGGGASLELLEGKVLPGV----
3c3bB           -VKATSRGCITIIGGDKVSHVSTGGGASLELLEGKVLPGV----
2cunA           GGGHSIASIQKYGIT-GITHISTGGGAMLSFFAGEELPVLRALQ
3c3bA           ----------TIIGGDKVSHVSTGGGASLELLEGKVLPGV----
3d01D           --------------------------------------------
3d01B           --------------------------------------------
2e28A           --------------------------------------------
3d01G           --------------------------------------------
3d01K           --------------------------------------------
3d01L           --------------------------------------------
3d01I           --------------------------------------------
3d01E           --------------------------------------------