[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55893.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d3o1.bssp"
#ERROR : Can't open dsspfile "3chxA.bssp"
#ERROR : Can't open dsspfile "1bl4A.bssp"
#ERROR : Can't open dsspfile "1bkfA.bssp"
#ERROR : Can't open dsspfile "2dg9A.bssp"
#ERROR : Can't open dsspfile "1c9hA.bssp"
#ERROR : Can't open dsspfile "2dg4A.bssp"
#ERROR : Can't open dsspfile "2d9fA.bssp"

## Summary of PDB Search
:501
    7e-19  27%  2d3o1  [x.x.x] TRIGGER FACTOR
    2e-05   4%  3chxA  [x.x.x] PMOB[MASQUE : MEMB(X) 46 / COIL(x) 0]
    3e-05  18%  1bl4A  [d.26.1] PROTEIN (FK506 BINDING PROTEIN)
    5e-05  20%  1bkfA  [x.x.x] FK506 BINDING PROTEIN
    6e-05  18%  2dg9A  [x.x.x] FK506-BINDING PROTEIN 1A
    8e-05  20%  1c9hA  [d.26.1] FKBP12.6
    1e-04  22%  2dg4A  [x.x.x] FK506-BINDING PROTEIN 1A
    2e-04  14%  2d9fA  [x.x.x] FK506-BINDING PROTEIN 8 VARIANT
:501

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGAEAVR
2d3o1           ----------------NKVEFKVSVPAAEVNRAYDQVWAGLARDVRVPGFRPGKAPRKVIENRVGKGYVE
3chxA           ----------------------------------------------------------------------
1bl4A           ----------------------------------------------------------------------
1bkfA           ----------------------------------------------------------------------
2dg9A           ----------------------------------------------------------------------
1c9hA           ----------------------------------------------------------------------
2dg4A           ----------------------------------------------------------------------
2d9fA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVxxxxxxxxxxxxxxxxxxPAEGT
2d3o1           SQVRDRLLETHYSQGLRELGLNL-VDATVDPQDV-QSGQAFEFTVKG-----------------------
3chxA           -----------------------------------------------------------------PRTIP
1bl4A           ----------------------------------------------------------------------
1bkfA           ----------------------------------------------------------------------
2dg9A           ----------------------------------------------------------------------
1c9hA           ----------------------------------------------------------------------
2dg4A           ----------------------------------------------------------------------
2d9fA           --------------------------------------------------------------------GS


                         +         .         .         .         .         *         .:210
query           TDAEIDEQIDALREHYYSFEDASAATKVKEDSYIDLAMKATDDKGEEIPSLTTENRPYGLGANLFPAEFD
2d3o1           ----------------------------------------------------------------------
3chxA           LQAGLQKPLTPIIVTAELKGGPGRELTIQVKVGEYTAAGLRFLNPDVFTTKDYLLADRGTDPTPLAPGET
1bl4A           --------------------------FPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKLGKQEVIRGWE
1bkfA           --------------------------FPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKLGKQEVIRGWE
2dg9A           --------------------------FPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKLGKQEVIRGLE
1c9hA           --------------------------FPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKIGKQEVIKGFE
2dg4A           --------------------------FPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKLGKQEVIRGFE
2d9fA           SGSSGEEWLDILGNGLLRKKTLVPGPRPVKGQVVTVHLQTSLENGTRVQE--EPELVFTLGDCDVIQALD


                         .         .         .         +         .         .         .:280
query           EQLVGLKKGQTATFTLDMPADxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2d3o1           ----------------------------------------------------------------------
3chxA           KTIEVKVQDARWDIERLSDLA-------------------------------------------------
1bl4A           EGVAQMSVGQRAKLTISPDYA-------------------------------------------------
1bkfA           EGVAQMSVGQRAKLTI------------------------------------------------------
2dg9A           EGVAQMSVGQRAKLTISPDYA-------------------------------------------------
1c9hA           EGAAQMSLGQRAKLTC------------------------------------------------------
2dg4A           EGVAQMSVGQRAKLTI------------------------------------------------------
2d9fA           LSVPLMDVGETAMVTA------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2d3o1           ----------------------------------------------------------------------
3chxA           ----------------------------------------------------------------------
1bl4A           ----------------------------------------------------------------------
1bkfA           ----------------------------------------------------------------------
2dg9A           ----------------------------------------------------------------------
1c9hA           ----------------------------------------------------------------------
2dg4A           ----------------------------------------------------------------------
2d9fA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2d3o1           ----------------------------------------------------------------------
3chxA           ----------------------------------------------------------------------
1bl4A           ----------------------------------------------------------------------
1bkfA           ----------------------------------------------------------------------
2dg9A           ----------------------------------------------------------------------
1c9hA           ----------------------------------------------------------------------
2dg4A           ----------------------------------------------------------------------
2d9fA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2d3o1           ----------------------------------------------------------------------
3chxA           ----------------------------------------------------------------------
1bl4A           ----------------------------------------------------------------------
1bkfA           ----------------------------------------------------------------------
2dg9A           ----------------------------------------------------------------------
1c9hA           ----------------------------------------------------------------------
2dg4A           ----------------------------------------------------------------------
2d9fA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxx
2d3o1           -----------
3chxA           -----------
1bl4A           -----------
1bkfA           -----------
2dg9A           -----------
1c9hA           -----------
2dg4A           -----------
2d9fA           -----------