[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV55965.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ea4A.bssp"
#ERROR : Can't open dsspfile "1ea4H.bssp"
#ERROR : Can't open dsspfile "1bazA.bssp"
#ERROR : Can't open dsspfile "2cpgA.bssp"
#ERROR : Can't open dsspfile "1ea4F.bssp"
#ERROR : Can't open dsspfile "1ea4E.bssp"
#ERROR : Can't open dsspfile "1b28A.bssp"
#ERROR : Can't open dsspfile "1ea4B.bssp"
#ERROR : Can't open dsspfile "1bdvD.bssp"
#ERROR : Can't open dsspfile "2cpgC.bssp"
#ERROR : Can't open dsspfile "1bazC.bssp"
#ERROR : Can't open dsspfile "2ay0C.bssp"
#ERROR : Can't open dsspfile "1bdtC.bssp"
#ERROR : Can't open dsspfile "2ay0D.bssp"
#ERROR : Can't open dsspfile "2ay0A.bssp"
#ERROR : Can't open dsspfile "2ay0B.bssp"

## Summary of PDB Search
:85
    1e-05  24%  1ea4A  [a.43.1] TRANSCRIPTIONAL REPRESSOR COPG
    2e-05  23%  1ea4H  [a.43.1] TRANSCRIPTIONAL REPRESSOR COPG
    3e-05  22%  1bazA  [a.43.1] ARC REPRESSOR
    5e-05  24%  2cpgA  [a.43.1] TRANSCRIPTIONAL REPRESSOR COPG
    5e-05  23%  1ea4F  [a.43.1] TRANSCRIPTIONAL REPRESSOR COPG
    6e-05  24%  1ea4E  [a.43.1] TRANSCRIPTIONAL REPRESSOR COPG
    1e-04  22%  1b28A  [a.43.1] PROTEIN (REGULATORY PROTEIN ARC)
    2e-04  26%  1ea4B  [a.43.1] TRANSCRIPTIONAL REPRESSOR COPG
    4e-04  22%  1bdvD  [a.43.1] PROTEIN (ARC FV10 REPRESSOR)
    4e-04  26%  2cpgC  [a.43.1] TRANSCRIPTIONAL REPRESSOR COPG
    5e-04  23%  1bazC  [a.43.1] ARC REPRESSOR
    5e-04  19%  2ay0C  [x.x.x] BIFUNCTIONAL PUTA PROTEIN
    6e-04  21%  1bdtC  [a.43.1] PROTEIN (GENE-REGULATING PROTEIN ARC)
    7e-04  19%  2ay0D  [x.x.x] BIFUNCTIONAL PUTA PROTEIN
    0.001  19%  2ay0A  [x.x.x] BIFUNCTIONAL PUTA PROTEIN
    0.001  20%  2ay0B  [x.x.x] BIFUNCTIONAL PUTA PROTEIN
:85

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGRTETKRVNVDMPIWMVEALDKEAKRVGIGRQAVIK
1ea4A           ---------------------------------------KRLTITLSESVLENLEKMAREMGLSKSAMIS
1ea4H           ---------------------------------------KRLTITLSESVLENLEKMAREMGLSKSAMIS
1bazA           ------------------------------------SKMPQVNLRWPREVLDLVRKVAEENGRSVNSEIY
2cpgA           --------------------------------------KKRLTITLSESVLENLEKMAREMGLSKSAMIS
1ea4F           --------------------------------------KKRLTITLSESVLENLEKMAREMGLSKSAMIS
1ea4E           --------------------------------------KKRLTITLSESVLENLEKMAREMGLSKSAMIS
1b28A           ----------------------------------GMSKMPQFNLRWPREVLDLVRKVAEENGMSVNSYIY
1ea4B           ---------------------------------------KRLTITLSESVLENLEKMAREMGLSKSAMIS
1bdvD           ------------------------------------SKMPQVNLRWPREVLDLVRKVAEENGRSVNSEIY
2cpgC           --------------------------------------KKRLTITLSESVLENLEKMAREMGLSKSAMIS
1bazC           ---------------------------------------PQVNLRWPREVLDLVRKVAEENGRSVNSEIY
2ay0C           --------------------------------------TTTMGVMLDDATRERIKSAATRIDRTPHWLIK
1bdtC           ----------------------------------GMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIY
2ay0D           --------------------------------------TTTMGVMLDDATRERIKSAATRIDRTPHWLIK
2ay0A           --------------------------------------TTTMGVMLDDATRERIKSAATRIDRTPHWLIK
2ay0B           --------------------------------------TTTMGVMLDDATRERIKSAATRIDRTPHWLIK


                         .         .         *         .         .         .         .:140
query           MWLAERLDEEARRSA
1ea4A           VALENYKKGQ-----
1ea4H           VALENYKKGQEK---
1bazA           QRVMESFKKEGRIGA
2cpgA           VALENYKKGQ-----
1ea4F           VALENYKKGQEK---
1ea4E           VALENYKKGQ-----
1b28A           QLVMESFKKEGRIGA
1ea4B           VALENYK--------
1bdvD           QRVMESFKKEGR---
2cpgC           VALENYK--------
1bazC           QRVMESFKKEGRI--
2ay0C           QAIFSYLEQL-----
1bdtC           QRVMESFKKEGR---
2ay0D           QAIFSYLEQL-----
2ay0A           QAIFSYLEQL-----
2ay0B           QAIFSYLEQ------