[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56026.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ekqA.bssp"
#ERROR : Can't open dsspfile "1ekkA.bssp"
#ERROR : Can't open dsspfile "1c3qA.bssp"
#ERROR : Can't open dsspfile "1ekqB.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"
#ERROR : Can't open dsspfile "2ax3A.bssp"
#ERROR : Can't open dsspfile "3bgkA.bssp"

## Summary of PDB Search
:278
    7e-23  33%  1ekqA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    6e-18  32%  1ekkA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    1e-16  31%  1c3qA  [c.72.1] PROTEIN (HYDROXYETHYLTHIAZOLE KINASE)
    5e-14  34%  1ekqB  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    2e-11  24%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE
    1e-05  12%  2ax3A  [x.x.x] HYPOTHETICAL PROTEIN TM0922
    3e-05  11%  3bgkA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
:278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxALKRALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICGGLTLNIGTLN
1ekqA           --------CLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1ekkA           --------CLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1c3qA           ----SAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
1ekqB           --------CLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS
3dzvA           ----SVKFETIFPLTTAPLIQCITNEITCE-SANALLYIDAKPIA-DDPREFPQFQQ-TSALVLNLGHLS
2ax3A           ----SLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLG-
3bgkA           -------------------------TVATHKDNITALHSHLPEAAFDVEKDRLSEQITAADVVLGPGLAE


                         .         .         *         .         .         .         .:140
query           ERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVVRGNMSEXXXXXXXXXXTRGV
1ekqA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGGDIIRLAQ
1ekkA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAE------IAHTVGVT
1c3qA           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGVTDWL---
1ekqB           KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGGGDIIRLA
3dzvA           QEREQSLLAASDYARQVNKLTVVDLVGYGASDIRNEVGEKLVHN-QPTVVKGNLSERTFCQLVSHPLDQS
2ax3A           -NNEHVREFVNEFLKTLEKPAVIDADAINVL-----DTSVLKERKSPAVLTPHPGEARLV----------
3bgkA           DDLAQTTFDVVWQAIEPKQTLIID-----GSAINLLAKRKAIWPTKQIILTPHQKEWE---------RLS


                         +         .         .         .         .         *         .:210
query           DVCPGDAVTEDNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERAYAVRNGSPLMGRITGAGCMLSCVC
1ekqA           QAAQKLNTV---------------------IAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGLLTSVVG
1ekkA           DWLIKGVDAGEGGGDIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGLLTSVVG
1c3qA           ---IKGVDAGEGGGDIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGCLLTSVV
1ekqB           QQAAQKLNT--------------------VIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGLLTSVVG
3dzvA           EEAIEELIQA--------LRQQTQKFPQTVFLATGIQDVLVSQEQVIVLQNGVPELDCFTGTGDLVGALV
2ax3A           ------KKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGL-SKGGSGDVLTGIA
3bgkA           GLTIPEQIEAATQ------TALAHFPKETILVAKSHQTKIYQGQKIGHIQVGGPYQ--ATGGGDTLAGIA


                         .         .         .         +         .         .         .:280
query           AAFATANPXXXXXXXXXXXXGMGLAGQIAQGRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELx
1ekqA           AFCAVEENPLFAAIAAISS--YGVAAQLAAQQTADK-GPGSFQIELLNKLSTVTEQDVQEWATIERV-
1ekkA           AFCAVEENPLFAAIAAISSY--GVAAQLAAQQTADK-GPGSFQIELLNKLSTVTEQDVQEWATIERV-
1c3qA           GAFCAVEENPLFAAIAAISSY-GVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIER--
1ekqB           AFCAVEENPLFAAIAAISS--YGVAAQLAAQQTADK-GPGSFQIELLNKLSTVTEQDVQEWATIERV-
3dzvA           AAL--LGEGNAPTAAVAAVSYFNLCGEKAKTKSQGL---ADFRQNTLNQLSLLKEKDWFEAVKGRVL-
2ax3A           GFIAQGLSPLEASTVSVYL--HGFAAELFEQD-----ERGLTASELLRLIPEA---------------
3bgkA           GFVA-QFHTDRFEVAAAAVFLHSYIADQLSKEAYV---------------------------------