[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56092.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bboK.bssp"
#ERROR : Can't open dsspfile "3cjtJ.bssp"
#ERROR : Can't open dsspfile "3cjqB.bssp"
#ERROR : Can't open dsspfile "3cjrB.bssp"
#ERROR : Can't open dsspfile "3cjqE.bssp"
#ERROR : Can't open dsspfile "3cjtB.bssp"
#ERROR : Can't open dsspfile "1aciA.bssp"
#ERROR : Can't open dsspfile "3cjtF.bssp"
#ERROR : Can't open dsspfile "3dllF.bssp"
#ERROR : Can't open dsspfile "3egvB.bssp"
#ERROR : Can't open dsspfile "3cjsB.bssp"
#ERROR : Can't open dsspfile "3cjtH.bssp"
#ERROR : Can't open dsspfile "3cjsC.bssp"

## Summary of PDB Search
:166
    4e-34  49%  3bboK  [x.x.x] RIBOSOMAL PROTEIN L11
    1e-28  45%  3cjtJ  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    6e-28  48%  3cjqB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    4e-26  48%  3cjrB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    6e-25  48%  3cjqE  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-24  46%  3cjtB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    4e-22  62%  1aciA  [x.x.x] L11 RIBOSOMAL PROTEIN
    6e-22  43%  3cjtF  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    2e-21  54%  3dllF  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    8e-19  44%  3egvB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    6e-14  42%  3cjsB  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    1e-13  41%  3cjtH  [x.x.x] 50S RIBOSOMAL PROTEIN L11
    3e-12  40%  3cjsC  [x.x.x] 50S RIBOSOMAL PROTEIN L11
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxKKQTGFIKLQIXXXXXXXXXXXXXXXXXXXVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTFV
3bboK           ---KKVIGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKPGFVIPVEITVFDDKSFTFI
3cjtJ           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3cjqB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFV
3cjrB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFV
3cjqE           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFV
3cjtB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
1aciA           -------------------------------------------------------------------TFI
3cjtF           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3dllF           ----------------------------------------------------------------------
3egvB           ---KKVVAVVKLQLPAGAATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3cjsB           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3cjtH           ---KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV
3cjsC           ----KVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFV


                         .         .         *         .         .         .         .:140
query           CKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRI
3bboK           LKTPPASVLLLKASGAEKGSKDPQMEKVGKITIDQLRGIATEKLPDLNCTTIESAMRIIAGTAANMGIDI
3cjtJ           TKTPPASYLIRKAAGLEKGAHKPG-------REKVGREIAKQKMP------LEAAARMIAGSARSMGVEV
3cjqB           TKTPPASYLIR-------------------ITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEV
3cjrB           TKTPPASYLIRITW-------------------EQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGV--
3cjqE           TKTPPASYLIR-------------------ITWEQVLEIAKQKMP------LEAAARMIAGSARSMGVEV
3cjtB           TKTPPASYLIRKAAGLEKGAHKPGREKVG-------REIAKQKMP------LEAAARMIAGSARSMGVEV
1aciA           TKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVV
3cjtF           TKTPPASYLIRKAAGLEKG----HKPGREKVGREQVLEIAKQKMP------LEAAARMIAGSARSMGVEV
3dllF           -KTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTV
3egvB           TKTPPASYLI------------------------------------------------------------
3cjsB           TKTP------------------------------------------------------------------
3cjtH           TKT-------------------------------------------------------------------
3cjsC           TK--------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGxxxxxxxxxxxxxxxxxxxxxxxx
3bboK           D-------------------------
3cjtJ           VG------------------------
3cjqB           VG------------------------
3cjrB           --------------------------
3cjqE           VG------------------------
3cjtB           VG------------------------
1aciA           E-------------------------
3cjtF           VG------------------------
3dllF           E-------------------------
3egvB           --------------------------
3cjsB           --------------------------
3cjtH           --------------------------
3cjsC           --------------------------