[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56128.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bbnN.bssp"
#ERROR : Can't open dsspfile "3e1aG.bssp"

## Summary of PDB Search
:61
    4e-15  42%  3bbnN  [x.x.x] RIBOSOMAL PROTEIN S14
    1e-14  47%  3e1aG  [x.x.x] 30S RIBOSOMAL PROTEIN S14
:61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxKAKREPKFSTRQHNRCTRCGRPRAYYRKFGLCRVCLRELANKGELPGVTKASW
3bbnN           --------QSPPRNSAPARLHRRCFLTGRPRANIRDFGLSGHILREMVHTCLLPGATRSSW
3e1aG           --------QTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW