[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56185.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c2vA.bssp"
#ERROR : Can't open dsspfile "3c2oA.bssp"
#ERROR : Can't open dsspfile "3dhfA.bssp"
#ERROR : Can't open dsspfile "2e5bA.bssp"
#ERROR : Can't open dsspfile "2b7nA.bssp"
#ERROR : Can't open dsspfile "3e7sA.bssp"
#ERROR : Can't open dsspfile "3eahB.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "3eahA.bssp"
#ERROR : Can't open dsspfile "3e7sB.bssp"
#ERROR : Can't open dsspfile "2ekeD.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "2ashA.bssp"
#ERROR : Can't open dsspfile "3dqsA.bssp"
#ERROR : Can't open dsspfile "1df1A.bssp"
#ERROR : Can't open dsspfile "3dqtB.bssp"

## Summary of PDB Search
:280
    1e-28  24%  3c2vA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    7e-27  24%  3c2oA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-21  12%  3dhfA  [x.x.x] NICOTINAMIDE PHOSPHORIBOSYLTRANSFERASE
    4e-21  11%  2e5bA  [x.x.x] NICOTINAMIDE PHOSPHORIBOSYLTRANSFERASE
    5e-20  26%  2b7nA  [x.x.x] PROBABLE NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-05  14%  3e7sA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    2e-05  11%  3eahB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    2e-05  20%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    5e-05  13%  3eahA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    7e-05  15%  3e7sB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    1e-04  12%  2ekeD  [x.x.x] UBIQUITIN-LIKE PROTEIN SMT3
    3e-04  10%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    3e-04  17%  2ashA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    4e-04  15%  3dqsA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    7e-04  14%  1df1A  [d.174.1] NITRIC OXIDE SYNTHASE
    8e-04  14%  3dqtB  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
:280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxISDTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLGCDVVEARRDG
3c2vA           -------DVTNWLSEDVPSFDFGGYV--VGSDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEG
3c2oA           -------DVTNWLSEDVPSFDFGGYVVG--SDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEG
3dhfA           -------GLQYILNKYLKGKVVTKEKIQ-EAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEG
2e5bA           -----------ILNKYLKGKVVTKEKI-QEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEG
2b7nA           ---EIRTFLERALKEDLGHGDLFERVLEK-DFKATAFVRAKQEGVFSGEKYALELLEMTGIECVQTIKDK
3e7sA           ----------------------------------------------------------------------
3eahB           ----------------------------------------------------------------------
3c2eA           -------DVTNWLSEDVPSFDFGG--YVVGSDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEG
3eahA           ----------------------------------------------------------------------
3e7sB           ----------------------------------------------------------------------
2ekeD           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2ashA           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------------
1df1A           ----------------------------------------------------------------------
3dqtB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAENPRCEVLTTRKSMPGAKDLL
3c2vA           SFLEPSKNDSKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLE
3c2oA           SFLEPSKNDSKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLE
3dhfA           FVIPRGNVLFTVENTDPECYWLTNWIETILWYPITVATNSREQKKIL---AKYLLETSGNLDGLEYK---
2e5bA           FVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYK---
2b7nA           ERFKPKDALMEIRGDFSMLLKVERTLLNLLQHSSGIATLTSRFVEAL--NSHKVRLLDTRKTRPLLRIFE
3e7sA           ----------------------------------------------------------------------
3eahB           ---------------------------------------------YSSIKRSGSQAHEQRLQEVEAETYQ
3c2eA           SFLEPSKNDSKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLE
3eahA           ----------------------------------------------------------------------
3e7sB           ----------------------------------------------------------------------
2ekeD           ---------------------------PLVPRGSEVKPKPETHINLKVSDGSSEIFFKIKKTTPLRRLME
2a4aA           ------------------------------------------------------------TDSMEKVLND
2ashA           ----------------------------------------------------------------------
3dqsA           ----------------------------------------------------------------SIKRSG
1df1A           ----------------------------------------------------------------------
3dqtB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQLPDIKGRCVEKKLFVEADAERARVLARAGVD
3c2vA           KYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARAVCG--FAVKIEVECLEDEATEAIEAGAD
3c2oA           KYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARAVCG--FAVKIEVECLEDEATEAIEAGAD
3dhfA           ----LHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGL--ALIKKYYGTKDPVPGY-------------
2e5bA           ----LHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGL--ALIKKYYGTKDPVPGY-------------
2b7nA           KYSVLNGGASNHRLGLDDALMLKDTHLRHVKDLKSFLTHARKNLPFTAKIEIECE-SFEEAKNAMNAGAD
3e7sA           -----------------------------------------------------QEMFTYICNHIKYATNR
3eahB           LRESELVFGAKQAWRNAPRCVG-RIQWGKLQVFDA------------RDCRSAQEMFTYICNHIKYATNR
3c2eA           KYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSIT-NAVKNARAVCGFAVKIEVECLSEDEATEAIEAGAD
3eahA           ----------------------------------------------ARDCRSAQEMFTYICNHIKYATNR
3e7sB           ------------------------------------------------------EMFTYICNHIKYATNR
2ekeD           AFAKRQGKEMDSLRFLYDGIRIQADQ--------------------------------------------
2a4aA           TEKALDDGADEIDLVINYKKIIENTDEGLKEATKLTQSVKKLLTNKILKVIITEDLIIKTTLAVLNGNAD
2ashA           -----------------------------------------------VQGGIYPDLRRESALQLTSIGFD
3dqsA           SQAHEERLQEVEAE-VASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCSSAIKYATNR
1df1A           ----------------------------------------------------AQEMFQHICRHILYATNN
3dqtB           ------------------------------------------------------------CNHIKYATNR


                         .         .         .         +         .         .         .:280
query           GIQVDKVPVDELEPLVRELRAIDPHVTLIAAGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMxxx
3c2vA           VIMLDN------------------HFLLECSGGLNLDN--LYLCDDIDIYSTSSIHGTPVIDFSLKL---
3c2oA           VIMLDN------------------HFLLECSGGLNLCDDIDIYSTS------SIHQGTPVIDFSLKL---
3dhfA           ----------------------------------------------------------------------
2e5bA           ----------------------------------------------------------------------
2b7nA           IVMCDNLSVLETKEIAAYRDAHYPFVLLEASGNISLESINAYAKSGVDASVGALIHQATFIDMHMKM---
3e7sA           GNLRSAITVFPQRAPGRGDFRIWN-SQLVRYAGYRQQDGVRGDPANVEITELCIQHGWTP----------
3eahB           GNLRSAITVFPQRCPGRGDFRI-WNSQLVRYAGYRQQDGSVRGDANVEITELCIQHGWTP----------
3c2eA           VIMLDNHFLLECSGGLNLLDIYSTSSI-------------------------------------------
3eahA           GNLRSAITVFPQRCPGRGDFRI-WNSQLVRYAGYRQQDGVRGDPANVEITELCIQHGWTP----------
3e7sB           GNLRSAITVFPQRAPGRGDFRI-WNSQLVRYAGYRQQDGVRGDPANVEITELCIQHGWTP----------
2ekeD           ----------------------------------------------------------------------
2a4aA           FIKTSTGKIKAIKEYIKNNPEKNNKIGLKVSGGISLNTASHYILLARRFLSDNFRIGSSSL---------
2ashA           GYAIGGLSISLTLEMTEVTVFLPEDKPRYFMGGGSPELILELVDRGVDMDSVFPTRIA------------
3dqsA           GNLRSAITVFPQRAPGRGDFRI-WNSQLVRYAGYRQQDGVRGDPANVEITELCIQHGWTP----------
1df1A           GNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKP----------
3dqtB           GNLRSAITVFPQRAPGRGDFRI-WNSQLVRYAGYRQQDGVRGDPANVEITELCIQHGWTP----------