[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56230.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"

## Summary of PDB Search
:264
    6e-19   9%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    1e-18  44%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-17   9%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-17  20%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-16  10%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-15  16%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    3e-15   7%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    6e-15  27%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-15  14%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-15  14%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-15  19%  3cmvA  [x.x.x] PROTEIN RECA
    1e-14  11%  2akaB  [x.x.x] DYNAMIN-1
    6e-14  14%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-14  12%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-13  11%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-13  18%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-13  15%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-13  10%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-13  14%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-13  10%  2c9gA  [x.x.x] PENTON PROTEIN
    3e-13  14%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-13   9%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-13  15%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    4e-13  12%  2ctsA  [x.x.x] CITRATE SYNTHASE
    4e-13  13%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-13   8%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    8e-13  12%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-12  15%  1e0jA  [c.37.1] DNA HELICASE
    2e-12  12%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-12  10%  4dcgA  [x.x.x] VP39
    2e-12  14%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-12  22%  3cmvG  [x.x.x] PROTEIN RECA
    3e-12   8%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    4e-12  25%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-12  13%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    5e-12   6%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    5e-12  11%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    5e-12  16%  3cmvC  [x.x.x] PROTEIN RECA
    1e-11  39%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-11  14%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-11  12%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-11  29%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-11  14%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-11  11%  3cmvH  [x.x.x] PROTEIN RECA
    2e-11  27%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-11  14%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-11   7%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-11  14%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-11  26%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-11  14%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-11  29%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    4e-11  11%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-11  22%  3cmwC  [x.x.x] PROTEIN RECA
    7e-11  15%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    7e-11  11%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    7e-11  15%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    9e-11  12%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-10  16%  1e0jB  [c.37.1] DNA HELICASE
    1e-10  50%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-10  22%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-10  14%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-10  33%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-10  20%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    1e-10  25%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-10  16%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    2e-10  17%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-10  14%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-10  45%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-10  16%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    4e-10  11%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    4e-10  31%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-10  22%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    5e-10  11%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    6e-10  13%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    6e-10  15%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-10  11%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    7e-10   8%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    7e-10  11%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    9e-10   9%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    9e-10   9%  3da4A  [x.x.x] COLICIN-M
    9e-10  20%  3cm0A  [x.x.x] ADENYLATE KINASE
    9e-10  12%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    1e-09   9%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    1e-09  23%  3cmuA  [x.x.x] PROTEIN RECA
    1e-09  15%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-09  55%  2d2fA  [x.x.x] SUFC PROTEIN
    1e-09  50%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-09   7%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-09  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-09  56%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-09  16%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    3e-09  14%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-09  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09   8%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-09   9%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-09  12%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-09  18%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    3e-09  11%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-09  18%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-09  17%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-09  15%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    6e-09  21%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    6e-09  14%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-09  14%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    6e-09  22%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    6e-09  15%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    6e-09  22%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    7e-09   8%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    7e-09  12%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    7e-09  10%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    8e-09  17%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    8e-09  22%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    9e-09   5%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    9e-09  14%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-09  26%  3cmvB  [x.x.x] PROTEIN RECA
    1e-08  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-08  20%  2cckA  [x.x.x] THYMIDYLATE KINASE
    1e-08  12%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-08   8%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-08  16%  1e98A  [c.37.1] THYMIDYLATE KINASE
    1e-08  16%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    2e-08   2%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-08  15%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-08  16%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-08  11%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-08   6%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-08  12%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-08  16%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-08  10%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    3e-08  10%  2bifA  [c.37.1 - c.60.1] PROTEIN
    3e-08   6%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    3e-08   9%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    3e-08  33%  2ancB  [x.x.x] GUANYLATE KINASE
    3e-08  13%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    3e-08  20%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    3e-08  22%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-08  19%  1e2kA  [c.37.1] THYMIDINE KINASE
    4e-08   8%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    4e-08  20%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    4e-08  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-08  27%  3cmtD  [x.x.x] PROTEIN RECA
    5e-08  15%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    6e-08  33%  2anbA  [x.x.x] GUANYLATE KINASE
    7e-08  12%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    8e-08  18%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    8e-08  21%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-08  12%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    8e-08  21%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    8e-08  14%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    9e-08  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    9e-08  12%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-07  18%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-07  24%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-07  18%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    1e-07  21%  3c8uA  [x.x.x] FRUCTOKINASE
    1e-07   9%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-07  10%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    1e-07  13%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-07  12%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-07  15%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-07  14%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-07  23%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    2e-07  30%  2b8tD  [x.x.x] THYMIDINE KINASE
    2e-07  36%  2ancD  [x.x.x] GUANYLATE KINASE
    3e-07  17%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    3e-07  42%  2an9A  [x.x.x] GUANYLATE KINASE
    3e-07   8%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    3e-07   8%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    3e-07  16%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    3e-07  27%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    4e-07  31%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-07  26%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-07  12%  1eamA  [c.66.1] PROTEIN (VP39)
    5e-07   9%  2c9oC  [x.x.x] RUVB-LIKE 1
    7e-07  18%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    7e-07  16%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-07  20%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    9e-07  17%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-07  17%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    9e-07  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-07  26%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-06  33%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    1e-06  17%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-06   6%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-06   7%  2cgtH  [x.x.x] 60 KDA GROEL
    1e-06  15%  2ancF  [x.x.x] GUANYLATE KINASE
    1e-06   9%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    2e-06  21%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-06  17%  2bdtA  [x.x.x] BH3686
    2e-06   8%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-06   7%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    2e-06  26%  3cmvE  [x.x.x] PROTEIN RECA
    2e-06  21%  2cckB  [x.x.x] THYMIDYLATE KINASE
    2e-06  16%  3dkvA  [x.x.x] ADENYLATE KINASE
    3e-06  13%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    3e-06  24%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    3e-06  22%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    3e-06  17%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-06  28%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-06  13%  1e6cA  [c.37.1] SHIKIMATE KINASE
    3e-06  26%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-06  23%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    3e-06  10%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-06  13%  3adkA  [x.x.x] ADENYLATE KINASE
    4e-06   6%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    5e-06  22%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-06   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    6e-06  20%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    6e-06  11%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    6e-06  11%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-06   9%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    8e-06  12%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-06  13%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-06  16%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-06  11%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    9e-06   4%  3dfdA  [x.x.x] PROTEIN YQBN
    1e-05  24%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    1e-05  30%  2b8tC  [x.x.x] THYMIDINE KINASE
    2e-05  26%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    2e-05  39%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-05  24%  3a00A  [x.x.x] GUANYLATE KINASE
    2e-05  15%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-05  23%  3cmxA  [x.x.x] PROTEIN RECA
    2e-05  15%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-05  19%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-05   7%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    2e-05  10%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    3e-05  12%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    4e-05  15%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-05  41%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    5e-05  27%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    5e-05  22%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-05  12%  3bczC  [x.x.x] PROTEIN MEMO1
    6e-05  33%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    6e-05  16%  1e2jB  [c.37.1] THYMIDINE KINASE
    7e-05  22%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    1e-04  41%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-04  15%  1e2iA  [c.37.1] THYMIDINE KINASE
    1e-04  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-04  41%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-04  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    2e-04  16%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-04   6%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-04  24%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-04  15%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-04   9%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-04   6%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    3e-04  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-04  19%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-04  13%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    3e-04  16%  3be4A  [x.x.x] ADENYLATE KINASE
    4e-04  16%  1e2hA  [c.37.1] THYMIDINE KINASE
    4e-04  15%  1e2jA  [c.37.1] THYMIDINE KINASE
    4e-04  17%  1e2lA  [c.37.1] THYMIDINE KINASE
    4e-04  12%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    6e-04   4%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    7e-04  20%  1e2iB  [c.37.1] THYMIDINE KINASE
    7e-04  29%  1e2mB  [c.37.1] THYMIDINE KINASE
    7e-04   4%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    8e-04  14%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    8e-04  24%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    8e-04  15%  3dlbB  [x.x.x] ARGONAUTE
    9e-04  10%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    0.001  24%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTITTRDSLLTIRGLSASVDETPILHDIDLAVGPGETHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEF
3c95A           -------------------DLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANT--LRPEDADRLGI
2d3wB           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEF
2dwoA           ------LTQSRVQKIWVPVDH-RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTR--YLNWIGVPTKV
3b5jA           --------DITFRNIRFRYKSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRF--YIPENGQVLI
1e9sG           ------VSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
2akaA           -------------------AISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQY--LASVAGRNQA
2c61B           --------------PKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQ--ASVPGSESAF
2awnA           -------ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL--ETITSGDLFI
2bc9A           SEIHMTGPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAG--KKKGFSLGSTV
1e9sB           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
3cmvA           -----------VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAA--AQREGKTCAF
2akaB           -----------MEDLIPLVNRQDAFSAIGQNADDLPQIAVVGGQSAGKSSVLENFVGR--DFLPRGSGIV
1e9rA           ------VSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYT--GLLRGDRMVI
2c03B           ---------VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLAL--YYKGKGRRPLL
3dmdC           ---------KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANW--LKNHGFSVVI
3b85A           --------------------KTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQ--ALQSKQVSRII
3czpB           -----------------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTD--ALDPRQYHIVP
1e9sF           ---------GKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
1e9sL           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYT--GLLRGDRMVI
2c9gA           -TNKFKARVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGV-------
1e9sM           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
2dwpA           ----------------------SRVQKIWVPVDHRNSPVMVGLPARGKTYISKKLTR--YLNWIGVPTKV
1cr4A           --------LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQAL--QWGTAMGKKVG
2ctsA           ---------------ASSTNLKDILADLIPKEQAKTFRQQHGNTAVGQITVDMMYGG--MRGMKGLVYET
2b92B           ------GPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGK--KKGFSLGSTV
2dr3E           -----------------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWN--GLKMGEPGIY
2b8wA           ------GPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLA--GKKKGFSLGSTV
1e0jA           ---------HLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQAL--QWGTAMGKKVG
2c03A           ---------VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLAL--YYKGKGRRPLL
4dcgA           ---------------------------QRHG---ILDGATVVYIGSAPGTHIRYLRDH--FYNLGVIIKW
1e9rF           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
3cmvG           -----------VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIA--AAQREGKTCAF
2dr3A           --------------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLW--NGLKMGEPGIY
2awnD           -------ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLR--MIAGLETITSGDLFI
2c04A           ---------VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALY--YKGKGRRPLL
2czvA           ---------------------GGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEE--VDKEKLREARK
1d1cA           -------------------AISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQY--LASVAGRNQA
3cmvC           -----RLGEDRSMDVETISSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIA--AAQREGKTCAF
3d31A           --------MIEIESLSRKWK-NFSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGF--HVPDSGRILL
1cs4C           ----------------------------------THRLLLLGAGESGKSTIVKQMRI--LHVGEKATKVQ
1cjtC           ----------------------------------THRLLLLGAGESGKSTIVKQMRI--LHVGEKATKVQ
2awoC           ---------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKST--LLRMIAGLETITSGDLFI
1e9sE           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYT--GLLRGDRMVI
3cmvH           ---------DRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIA--AAQREGKTCAF
2awoA           -------ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL--ETITSGDLFI
3dm5A           --------------YEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARY--FQKRGYKVGV
3eiuB           ---------YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIAR--QASVPGSESAF
1culC           ----------------------------------THRLLLLGAGESGKSTIVKQMRI--LHVGEKATKVQ
2awnB           -------ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL--ETITSGDLFI
1e9sH           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYT--GLLRGDRMVI
3dhwC           --------MIKLSNITKVFHTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLL--ERPTEGSVLV
3c15C           ---------------------------------ATHRLLLLGAGESGKSTIVKQMR--ILHVNGEKATKV
3cmwC           -----------VETISTGSLS---LDIALGAGGMGRIVEIYGPESSGKTTLTLQVIAA--AQREGKTCAF
1e69A           -----------------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKW--VFGEKFDMIFA
3bgwD           -------------------SGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKN--MSDNDDVVNL
3czpA           --IDKDTYEKAVIELREALLE--AQFELKQQARFPVIILINGIEGAGKGETVKLLNE--WDPRLIEVQSF
3cr7C           ---------------------------------RGLTIWLTGLSASGKSTLAVELEHQ--LVRDRRVHAY
1e0jB           --------LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQAL--QWGTAMGKKVG
2d3wC           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLA--------------
1b0uA           -------NKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFL--EKPSEGAIIV
1e9sJ           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLR--ELAYTGLLRGDRMVI
2awoD           -------ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLR-----------------
3b60A           RVIDRATGDLEFRNVTFTYPEVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITR--FYDIDEGHILM
2d62A           -------AEVKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTT-------------------
2ccjB           -----------------------------------AFITFEGPEGSGKTTVINEVYH--RLVKDYDVIMT
3dm9B           --------------------SRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLAN--WLKNHGFSVVI
1e9rG           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
2d2eA           -------SQLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGD--PEYTVERGEI
1e9dA           ---------------------------------RGALIVLEGVDRAGKSTQSRKLVE--ALCAAGHRAEL
1azsC           -------------------------------YRATHRLLLLGAGESGKSTIVK--QMRILHVNGEKATKV
2bbsA           ---------EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMG-------------
1d6jB           ----------------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRL
1bifA           ----------------------------------PTLIVMVGLPARGKTYISKKLTRY--LNFIGVPTRE
1ckvA           MSVNSNAYDAGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYVEDRAGYWWI
3dmdB           ---------KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANW--LKNHGFSVVI
3bo6B           -SATNEDNFHSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDV-------------
2c61A           ---------YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQ--ASVPGSESAF
3c7kA           ---------------------------------------LLGAGESGKSTIVKQMKI--IFSGEDVKQYK
3bpbA           ----------IARTPARSLVDSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFDSVFVEDPVLCTS
3da4A           YFCNADRNLVLHPGISVYDAYH---FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHY--LWGNGAERSV
3cm0A           ----------------------------------GQAVIFLGPPGAGKGTQASRLAQ--ELGFKKLSTGD
3ch4B           --------------------------MAPLGGAPRLVLLFSGKRKSGKDFVTE--ALQSRLGADVCAVLR
2a5gA           ----------------------------------EMRILMLGLDAAGKTTILYKLKLG--QSVTTIPTVG
3cmuA           -----------VETISTGSLS---LDIALGAGGMGRIVEIYGPESSGKTTLTLQVIA--AAQREGKTCAF
1e4yA           ---------------------------------------LLGALVAGKGTQAQFIME--KYGIPQISTGD
2d2fA           -------SQLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILA--------------
2d3wA           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLA--------------
3b2qA           ---------YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQ--ASVPGSESAF
2b8tA           ----------------------------------GWIEFITGPMFAGKTAELIRRL--HRLEYADVKYLV
2d3wD           --------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTL-------------------
2ccgA           -----------------------------------AFITFEGPEGSGKTTVINEVYH--RLVKDYDVIMT
1e9sI           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYT--GLLRGDRMVI
2bbsB           ----------TTEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGE--LEPSEGKIKH
3e8aC           ----------------------------------THRLLLLGAGESGKSTIVKQMRIL--HVNGEKATKV
3eiuA           ---------YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIAR--QASVPGSESAF
1e9sD           ------VSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSV--LLRELAYTGLLRGDRMVI
2cvfA           -----------------------LDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLL--SGKKVAYVDT
2d7vA           --------VAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLR--PQVVFSGTSKP
3cr7D           ---------------------------------RGLTIWLTGLSASGKSTLAVELEHQ--LVRDRRVHAY
1e2dA           ---------------------------------RGALIVLEGVDRAGKSTQSRKLVE--ALCAAGHRAEL
2d7vB           -------FVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVL--------RPQVVF
2c9yA           ----------------------------------GIRAVLLGPPGAGKGTQAPRLAE--NFCVCHLATGD
1e9rB           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
3ed8A           ---------IELKGTDFKEDG-NILGHKLEYNFNSHNVYITATRGTQKNGIKANFTV--RHNVEDGSVQL
2a2zA           ----------------------------------IKKISIEGNIAAGKSTFVNILKQ--LCEDWEVVPEP
2bkiA           -------------------AIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRY--LTESYGTGQD
1e9cA           ---------------------------------RGALIVLEGVDRAGKSTQSRKLVE--ALCAAGHRAEL
3bh0A           ---------SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQA--KNMSDNDDVVNL
2axnA           LELT----QSRVQKIWVPVDH-RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIG-------
2a30B           ----------------------------------IKKISIEGNIAAGKSTFVNILKWE--VVPEPVARWC
1dg3A           MT----GPMCLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLMN--KLAGKKHTKGIWMWC
1cr2A           -----REHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQA--------------
2ahwD           -----------VKPPRINRVPVLSAQEAVNYIPDEATLCVLGAGLEATTLITALADKYKQISPTGLGDRA
1e9sA           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY--TGLLRGDRMVI
3cmvB           -----------VETISTGS---LSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIA-------------
2a2zD           ----------------------------------IKKISIEGNIAAGKSTFVNILKQ--LCEDWEVVPEP
2cckA           -----------------------------------AFITFEGPEGSGKTTVINEVYH--RLVKDYDVIMT
2ccgB           ----------------------------------SAFITFEGPEGSGKTTVINEVYH--RLVKDYDVIMT
3b2qB           --------------------TGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQ--ASVPGSESAF
1e98A           ---------------------------------RGALIVLEGVDRAGKSTQSRKLV--EALCAAGHRAEL
3clvA           -----------------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKD--TFHENTNTTI
1afrA           ------------------MPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKP--VEKCWQPQDFL
1bg0A           ----TKDVFDSIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDP-------------
2b8wB           MT----GPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMN--KLAGKKKGFSLGSTV
1cjuC           ----------------------------------THRLLLLGAGESGKSTIVKQMRIL--HVNGEKATKV
1d2zD           -------------------QDVFQIDEAANRLPPDQSKSKTSGKLNERPTVGVLLQLVQAELFSAADFVA
2a30D           ----------------------------------IKKISIEGNIAAGKSTFVNILKQ--LCEDWEVVPEP
3bb1F           --------WSGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVN--SIIGERVVSISPFQS
2eg5G           ------NSAYNQLVLAKVKPVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDSIDKVGQLERPTIQI
2bifA           ----------------------------------PTLIVMVGLPARGKTYISKKLTR--YLNFIGVPTRE
3d3kA           ----------------SYELHKKLLVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLCGPHVK
1dkiA           ----------DSKGIHYNQNPYNLLTPVIEKVKPGEQSGQHAATGSVATATAQIMKY--HNYPNKGLKDY
2ancB           --------------------------------AQGTLYIVSAPSGAGKSSLIQALL--------------
1ek0A           --------------------------------------VLLGEAAVGKSSIVLRFVSN--DFAENKEPTI
3b9qA           --------IKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGK----------------------
3bb1G           --------WSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKS---------------------
1e2kA           ---------------------------------TLLRVYIDGPHGMGKTTTTQLLVAD--DIVYVPEPMT
2axpA           -------------------------------------IILEGPDCCFKSTVAAKLSK--ELKYPIIKGSS
1cr0A           --------LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGK----------------------
3dt2A           ----------------------MLILGITNPEGKKKYLAAAFPSACGKTN--LAMMNPTLPGWKVECVGD
3cmtD           --------------------STGSLSDIALGAGMGRIVEIYGPESSGKTTLTLQVIA--AAQREGKTCAF
2bkhA           ----------------------DKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRY--LTESYGTGQD
2anbA           --------------------------------AQGTLYIVSAPSGAGKSSLIQALL--------------
3a1wA           --------------------------------------ALAGCPNVGKTSLFNALTGT--KQYVANWPGV
2cjwB           ---------------------------------TYYRVVLIGEQGVGKSTLANIFAG--VEDTYERTLMV
3bb1C           ---------SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSST-------------------
3c14C           ----------------------------------THRLLLLGAGESGKSTIVKQMR--ILHVNGEKATKV
2a2zB           ----------------------------------IKKISIEGNIAAGKSTFVNILKQL--CEDWEVVPEP
1dekA           ---------------------------------------LSGVKRSGKDTTADFIMS--NYSAVKYQLAG
421pA           ---------------------------------TEYKLVVVGARGVGKSAL--TIQLIQNHFVDEYDPTI
3dt4A           ------CFALRIASRLAKEEEHMLILGITNPEGKKKYLAAAFPSACGKTNLAM--MNPTLPGWKVECVGD
2d4hB           MT----GPMCLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLGIWMWCV--PHPKKPGHIL
2cbzA           -------NSITVRNATFTWADPPTLNGITFSIPEGALVAVVGQVGCGK----------------------
3do6A           -----KDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSS--LNRIGKKSIVT
3c8uA           ---------------TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAA-------------
3bgwA           --------------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKN--MSDNDDVVNL
2dr3F           --------------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWN--GLKMGEPGIY
1e9rD           ------VSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSV--LLRELAYTGLLRGDRMVI
1bmfC           ---------IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAI--DTIINQKRFNDGTDE
3cr7A           ----------------------------------GLTIWLTGLSASGKSTLAVELEHQ--LVRDRRVHAY
3d7wA           ----------------------PLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVT--NLYVVAYEAG
2d4hA           --IHMTGPMCLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLMN--KLAGKKKGFSLGSTV
2a30A           ----------------------------------IKKISIEGNIAAGKSTFVNILKQL--CEDWEVVPEP
2b8tD           ----------------------------------GWIEFITGPMFAGKTAELIRRLH-------------
2ancD           ----------------------------------GTLYIVSAPSGAGKSSLIQALL--------------
1cr1A           -----REHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALAMGKKVGLAMLEE
2an9A           --------------------------------AQGTLYIVSAPSGAGKSSL-------------------
2dr3C           --------------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWN--GLKMGEPGIY
2dr3D           --------------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQ--QFLWNGLKMGEPGIY
2bwjA           ---------------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVE--KYGFTHLSTEL
1e9fA           ---------------------------------RGALIVLEGVDGAGKSTQSRKLV--EALCAAGHRAEL
2bbtA           ---------EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSL-------------------
2bbtB           ------GFGELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGK----------------------
1eamA           -----------------------------LQRHGILDGATVVYIGSAPGTHIR--YLRDHFYNLGVIIKW
2c9oC           -----------LVGQENAREACVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQE--LGSKVPFCPM
2dflA           -----------------STGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSV-------------
1e9rE           ------VSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELA--------------
3crmA           ---------------------------------LPPAIFLMGPTAAGKTDLAMALAD--ALPCELISVDS
3bb1H           ---------SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGE--RVVSISPFQS
2bkeA           --FKTALEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQ--------------------
2bboA           -------TEVVMENVTAFWEGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLM-----------------
1d6jA           ----------------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELE--------------
1e2fA           ---------------------------------RGALIVLEGVDRAGKSTQSRKLVE-------------
3bb1A           -----------INTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGE--RVVSISPFQS
3cddC           --------------------------------------KAGGKIYQGWTKIGITRSLEASGAFDLYKAFI
2cgtH           -----------FGAPTITKDGVSVAREIELEDKFNMGAQMVKEVASKANDAAGD--GTTTATVLAQAIIT
2ancF           --------------------------------AQGTLYIVSAPSGAGKSSLIQALL--KTQPLYDTQEAI
2ahvA           -------------------VPVLSAQEAVNYIPDEATLCVLGAGGGATTLITALADKYKQISPTGLGDRA
3bb1E           --------WSGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSST-------------------
2bdtA           -----------------------------------KLYIITGPAGVGKSTTCKRLAA--QLDNSAYIEGD
2d4uA           ---------------------------------------PLGSGGLFFNALKNCKEN--FTVLQTIRQQQ
1dw9A           --------------------------ILLSKAKKDLSFAEIDGTGLAEAFVTAALLG--QQALPADAARL
3cmvE           -----------VETISTGS---LSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIA-------------
2cckB           --------------------------------------TFEGPEGSGKTTVINEVYHR--LVKDYDVIMT
3dkvA           --------------------------------------VLMGLPGAGKGTQAERIVE----KYGIPHIST
3di4A           --------------------LVPPREGRCFEVKAGQFFRISSVEGPQVGDLNL-------HNLHDLTERF
2dpyB           -------------------DTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMAR--YTRADVIVVGL
3cnlA           -------------------GEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLK--------------
3dtbB           -------------------AEHMLILGITNPEGKKKYLAAAFPSACGKTNLAM--MNPTLPGWKVECVGD
3a00B           -----------------------------------RPIVISGPSGTGKSTLLK--KLFAEYPDSFGFSVS
1e6cA           -----------------------------------EPIFMVGARGCGMTTVGRELARA--LGYEFVDTDI
1e2gA           ---------------------------------RGALIVLEGVDRAGKSTQSRKLVEA--LCAAGHRAEL
2dpyA           -------------------DTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMAR--YTRADVIVVGL
3cr7B           ----------------------------------GLTIWLTGLSASGKSTLAVELEHQ--LVRDRRVHAY
3adkA           ---------------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIV--QKYGYTHLSTGD
1e3aB           --------------------QQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDP--RLPVPGTGKW
3d3qA           ----------------------------------PFLIVIVGPTASGKTELSIEVAK--KFNGEIISGDS
3cqcA           --------LKQGNAIMLASKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCI--------------
3d3qB           ----------------------------------PFLIVIVGPTASGKTELSI--EVAKKFNGEIISGDS
1e1qB           ------------ISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTII--NQKRFNDGTDE
3dt7A           --------------------EHMLILGITNPEGKKKYLAAAFPSACGKTNLAM--MNPTLPGWKVECVGD
2dr3B           ---------------------PGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFL--WNGLKMGEPGIY
3dt4C           SLLGKKCFALRIASRLAKEEEHMLILGITNPEGKKKYLAAAFPSACGKTNLAM--MNPTLPGWKVECVGD
1cjvC           ----------------------------------THRLLLLGAGESGKSTIVKQMRIL--HVEKATKVQD
3bb1D           ---------SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGE--RVVSISPFQS
3brwA           ----TTKVKLECNPTARIYLGKEHFNYYSLDTALGHLVFSLKYDVIGDQE--------------------
3dfdA           ---------IDAEEVEVPISVDKEGNVVPFKAITTDRIDELEKENTTKEL---------DSQRFYARIAV
3cueF           -------------------------------YDYLFKLLLIGNSGVGKSCLLLRFS--------------
2b8tC           ----------------------------------GWIEFITGPMFAGKTAELIRRLH-------------
3bwdD           ----------------------------------FIKCVTVGDGAVGKTCLLI-----------------
2awnC           ---------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLR-----------------
3a00A           --------------------------------------VISGPSGTGKSTLLKKLFAE--YPDSFGFSVS
3dmdA           --------VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGK----------------------
3cmxA           -------------------------------LPMGRIVEIYGPESSGKTTLTLQVIA--AAQREGKTCAF
3cddB           -----------------------AGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKA-------
2bjbA           -TELMLDALQTLGLRVDGVGSELTVSGRIEPGPGAR--VDCGLAG----TVLRFVPP--LAALGSVPVTF
1ai4B           ---------------------------LTINWYYADVNGNIGYVHTGAYPDRQSGH--------------
2ck3C           ---------IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIIN--QKRFNDGTDE
1av6A           ----------------------------------ILDGATVVYIGSAPGTH-------------------
1e9sK           ----------KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYT--GLLRGDRMVI
1ak2A           ----------------------------------GVRAVLLGPPGAGKGTQAPKLA--------------
3b85B           ---------------------TLGQKHYVDAIDTNTIVFGLGPAGSGKTYL-------------------
3bb1B           ---------SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSS--------------------
3bczC           -----------------------------SHAGSWYTASGPQLNAQLEGWLSQVQS--TKRPARAIIAPH
2ccjA           -----------------------------------AFITFEGPEGSGKTTVIN-----------------
1e2jB           -------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVA--LGSRDDIVYVP
2bwjB           -----------------------------EDLRKCKIIFIIGGPGSGKGTQCEKLVE--KYGFTHLST--
1akeA           ---------------------------------------LLGAPGAGKGTQAQFIM--------------
1e2iA           ---------------------------------TLLRVYIDGPHGMGKTDDIVYVPE--PMTYWRVLGAS
3cioD           -------------------------HFAMMETENNILMITGATPDSGKTFVSSTLAA--VIAQSDQKVLF
2b8tB           ----------------------------------GWIEFITGPMFAGKTAE-------------------
3dvlD           -------------------------------LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFV
1e2hB           -------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVA--LGSRDDIVYVP
3cddD           -----------------KAGGKIYQGWTKIGI-----TRSLEASGAFDLET---YKFNDA---QYKAFIE
3cnnA           --------------------EPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKG-------------
3e70C           --------KEAVSEILETSRR-IDLIEEIRKAEKPYVIMFVGFNGSGK----------------------
1e2kB           ---------------------------------TLLRVYIDGPHGMGKTTTTQLLVA--LGSRDDIVYVP
3cd9A           --------------------ILGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNI--EDGSVQLADHY
1e59A           -------------------------------VRHGESQWNKENRFTGWYDVDLSEKG--VSEAKAAGKLL
1dvrA           ---------------------------------ESIRMVLIGPPGAGKGTQAPNLQER--FHAAHLATGD
1accA           --------------------TARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIAFFNEPNGNLQY
3be4A           ---------------------------------KKHNLILIGAPGSGKGTQCE--FIKKEYGLAHLSTGD
1e2hA           ---------------------------------TLLRVYIDGPHGMGKTTTTQLLRD--DIVYVPEPMTY
1e2jA           ---------------------------------TLLRVYIDGPHGMGKTTTTQLLRDVYVPEPMTYWRVL
1e2lA           -------------------------------MPTLLRVYIDGPHGMGKTTTTQLLDI--VYVPEPMTYWR
3dm5B           ---------IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTT-------------------
1d6aA           ------------------------ISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIE---NQVKTNFNRA
1e2iB           ---------------------------------TLLRVYIDGPHGMGKTTTTQLLVA--LGSRDDIVYVP
1e2mB           ---------------------------------TLLRVYIDGPHGMGKTTTTQLLVA-------------
1e3mA           --------------------EKQLYEELFDLLLPHLEALQQSASLVNLAERAYTLNYT--CPTFIDKPGI
1dapA           ------------------------FDSEHTGMPHGGHVITTGDTGGFNHTVEYILKLDRNPDFTASSQIA
2bwjD           ---------------------------------KCKIIFIIGGPGSGKGTQCEKLVE--KYGFTHLST--
3dlbB           -----------------------------VWVEGLAVYRREHARGPGWR---------------------
2bhjA           ------------------------------------------------------------KNWGSGEILH
2ax4B           ---------------------------------RGCTVWLTGLSGAGKTTISFALEEY-LVSHAIPCYSL


                         .         .         *         .         .         .         .:140
query           DGRDITDLSPDKRSRAGLFLSFQAPVEIPGVPLSSFLRATVAGRDGKELKGKQFKKHVRTLADELDMDPS
3c95A           NRQHCLDNLKILRENPQVREKVVAIFAES-----------------------------------------
2d3wB           KGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPED
2dwoA           FNVGEYRREAVKQYSSYNFFRPDNEALAALRDVKSYLAKEGGQIAVFDATNTT--RERRHMILHFAKEND
3b5jA           DGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNT-
1e9sG           VDPNGDMLSK-FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAESYGRLLLRETA
2akaA           NGSGVLEQQILQANP-------------------------------------------------------
2c61B           AVVFAAMGITNEEAQYFMSDFEKTGALERA----------------------------------------
2awnA           GEKRMNDTPPAER---------------------------------------------------------
2bc9A           QSHTKGIWMWC-----------------------------------------------------------
1e9sB           VDPNGDMLSKFGRDKDIILNPYD-----------------------------------------------
3cmvA           IDAEHALDPIYARKLGVDI---------------------------------------------------
2akaB           TRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPISPHVLNLTLVDLPG
1e9rA           VDPNGDMLSKFGRDKDIILNPY------------------------------------------------
2c03B           VAADTQRPAAREQLRLLGEKVGV-----------------------------------------------
3dmdC           AASDTFRAGAIEQLEEHIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
3b85A           LTRPAVEAGEKLGFLPG-----------------------------------------------------
3czpB           IAAPTEEERA------------------------------------------------------------
1e9sF           VDPNGDMLSKFGRDKDIILN-PYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGEAEEWASYGRLLLRET-
1e9sL           VDPNGDMLSKFGRDKDIILNPYD-----------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e9sM           VDPNGDMLSKFGRDKDIILNPYD-----------------------------------------------
2dwpA           FNVGEYRREAVKQYSSYAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRER--RHMILHFAKEND
1cr4A           LAMLEESVEETAE---------------------------------------------------------
2ctsA           SVLDPDEGIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVV
2b92B           QSHTKGIWMWCVPHP-------------------------------------------------------
2dr3E           VALEEHPVQVRQNMA-------------------------------------------------------
2b8wA           QSHTKGIWMWCVPHKPGHILVLLDTEGLGD----------------------------------------
1e0jA           LAMLEESV--------------------------------------------------------------
2c03A           VAADTQRPAAREQLRLLGEKVGV-----------------------------------------------
4dcgA           MLIDGRHHDPILNGLRDVTLVTR-----------------------------------------------
1e9rF           VDPNGDMLSKFGRDKDIIL---------------------------------------------------
3cmvG           IDAEHALDPIYAR---------------------------------------------------------
2dr3A           VALEEHPVQVRQN---------------------------------------------------------
2awnD           GEKRMNDTPPAERGVGMVEPSVF-----------------------------------------------
2c04A           VAADTQRPAAR-----------------------------------------------------------
2czvA           EYGKVAILLSNPKPSLVRDTVQKFKSYLIYVESNDLRIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNV
1d1cA           GVLEQQILQANPILEAFGN----AKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSET
3cmvC           IDAEHALDPIYARKLGVDIDNL------------------------------------------------
3d31A           DGKDVTDLSPEKH---------------------------------------------------------
1cs4C           DIKNNLKEAIETIVAAMSNLVPP-----------------------------------------------
1cjtC           DIKNNLKEAIETIVMSNLVPPVELA---------------------------------------------
2awoC           GEKRMNDTPPAER---------------------------------------------------------
1e9sE           VDPNGDMLSKFGRDKDIIL---------------------------------------------------
3cmvH           IDAEHALDPIYARKLGVDIDNLLCSQPDT-GEQALEICDALARSGAVDV------IVVDSVAALTPKAEI
2awoA           GEKRMNDTPPAER---------------------------------------------------------
3dm5A           VCSDTWRPGAYHQLRQLLD---------------------------------------------------
3eiuB           AVVFAAMGITNEEAQYFMSDFEKTGALERA----------------------------------------
1culC           DIKNNLKEAIETIVAAMSNL-VPPV---------------------------------------------
2awnB           GEKRM-----------------------------------------------------------------
1e9sH           VDPNGDMLSKFGRDKDIIL---------------------------------------------------
3dhwC           DGQELTTLSESELTK-------------------------------------------------------
3c15C           QDIKNNLKEAIETIVAAMS---------------------------------------------------
3cmwC           IDAEHALDPIYARKLGVDI---------------------------------------------------
1e69A           GSENLPPAGSAYVEL-------------------------------------------------------
3bgwD           HSLEMGKKENIKRLI-------------------------------------------------------
3czpA           LRPSDEELERPPQWR-------------------------------------------------------
3cr7C           RLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPF-
1e0jB           LAMLEESVEE------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1b0uA           NG--------------------------------------------------------------------
1e9sJ           VDPNGDMLSKFGRDKDIIL---------------------------------------------------
2awoD           ----------------------------------------------------------------------
3b60A           DGHDLREYTLASLRNQVALVSQNVHLFNTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTI
2d62A           ----------------------------------------------------------------------
2ccjB           REPGGVPTGEEIRKIVLEGNDMD-----------------------------------------------
3dm9B           AASDTFRAGAIEQLE-------------------------------------------------------
1e9rG           VDPNGDMLSKFGRDKDIIL---------------------------------------------------
2d2eA           LLDGENIL--------------------------------------------------------------
1e9dA           LRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRY-AFSGVAYTGA
1azsC           QDIKNNLKEAIETIVAAMS---------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1d6jB           DGDNIR----------------------------------------------------------------
1bifA           FNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKVRKFLSEEGGHVAVFDATNTTRER--RAMIFNFGEQNG
1ckvA           KANGKIEVDCDEI-SELLGRQFNVYDFLVD----------------------------------------
3dmdB           AASDTFRAGAIEQLE-------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2c61A           AVVFAAMGITNEEAQ-------------------------------------------------------
3c7kA           PVVYSNTIQSLAAIV-------------------------------------------------------
3bpbA           RCAIITRPGAESRRGETEIIEETVQRFY---PGKVERIEAPGTVEAGDIMMVGDHFYIG-ESARTNAEGA
3da4A           NIANIGLKISPMKIN-------------------------------------------------------
3cm0A           ILRDHVARGTPLGERVRPI--MERGDLVPDDLILELIREELAERVI--FDGFPRTLAQAEALDRL-----
3ch4B           LSGPLKEQYAQEHGL-------------------------------------------------------
2a5gA           FNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAI
3cmuA           IDAEHALDPIYARKLGVDI---------------------------------------------------
1e4yA           MLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRPQADAMKEAGINVDY
2d2fA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3b2qA           AVVFAAMGITNEEAQYFMSDFEK-----------------------------------------------
2b8tA           FKPKIDTRSIRNI-QSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAE
2d3wD           ----------------------------------------------------------------------
2ccgA           REPGGVPTGEEIRKIVLEGNDMD-----------------------------------------------
1e9sI           VDPNGDMLSKFG----------------------------------------------------------
2bbsB           SGRISFCSQNSWI---------------------------------------------------------
3e8aC           QDIKNNL---KEAIETIVAAMSNLVPPVE-----------------------------------------
3eiuA           AVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADAYEHGMHVLVILTDITNYAEALRQMGPGYMYT
1e9sD           VDPNGDMLSK------------------------------------------------------------
2cvfA           EGGFSPERLVQMAETRGLNPEE------------------------------------------------
2d7vA           TLQQL-EKHHLAHENCFIANSVETEVVTE-----------------------------------------
3cr7D           RLDGDNIRFGLNKDLG------------------------------------------------------
1e2dA           LRFPERSTEIGKLLSSYLQKKSD------VEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSG-
2d7vB           SGTSKPTLQQLEHENCFIANSVETEVVTE-----------------------------------------
2c9yA           MLRAMVASGSELG---------------------------------------------------------
1e9rB           VDPNGDMLSKFGRDKDIIL---------------------------------------------------
3ed8A           ADHYQQNTPIGDG---------------------------------------------------------
2a2zA           VARWCNVQSTNV----------------------------------------------------------
2bkiA           IDDRI-----------------------------------------------------------------
1e9cA           LRFPERSTEIGKLLSSYLQKKSDVE---------------------------------------------
3bh0A           HSLEMG----------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2a30B           NVQSTNVLQMMYEKPERWSFTFQTYACLSRIR---AQLASLNDAEKPVLFFERSVYSDRYIFASNLYESE
1dg3A           VPHPKK----------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2ahwD           DRGISPLAQEGLVKW-------------------------------------------------------
1e9sA           VDPNGDMLSKFGRDKDIILNPYD-----------------------------------------------
3cmvB           ----------------------------------------------------------------------
2a2zD           VARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESE
2cckA           REPGGVPTGEEIR---------------------------------------------------------
2ccgB           REPGGVPTGEEIRKIVLEG-----------NDMDIRTEAMLFAASRREHL-VLKVIPALKEGKVVLCD-R
3b2qB           AVVFAAMGITNEEAQYFMSDFEKTGALERA----------------------------------------
1e98A           LRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRY-AFSGVAFTGA
3clvA           GASFCT----------------------------------------------------------------
1afrA           PDPASDG---------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2b8wB           QSHTKG----------------------------------------------------------------
1cjuC           QDIKNNLKEAIET---------------------------------------------------------
1d2zD           LDFLNESTPARPVDGP------------------------------------------------------
2a30D           VARWCNVQSTNVLQMMYEKPERW-SFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLESE
3bb1F           EGPR------------------------------------------------------------------
2eg5G           FLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPS
2bifA           FNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKVRKFLSEEGGHVAVFDATNTT-RERRA-MIFNFGEQNG
3d3kA           GAQGISCGRHLANHD-------------------------------------------------------
1dkiA           TYTLSSNNPYFNHPKNLFAAISTRQ----------YNWNNILPTYSGRESNVQKMAISELMADVGISVDM
2ancB           ----------------------------------------------------------------------
1ek0A           GAAFLTQRVTINEHT-------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1e2kA           YWRVLGASETIAN---------------------------------------------------------
2axpA           FELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKVVYLHADPSVIKK
1cr0A           ----------------------------------------------------------------------
3dt2A           DIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFT----NVAETSDGGVYWEGIDEP
3cmtD           IDAEHALDPIYARKLGVDIDNLL-----------------------------------------------
2bkhA           IDDRIV----------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3a1wA           TVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQS---LYLLLE
2cjwB           DGESATIILLDMWENHDHMQ-VGDAYLIVY---SITDRASFEKASELRIQLRRARQTEDIPIILVGNK--
3bb1C           ----------------------------------------------------------------------
3c14C           QDIKNNLKEAIETIVA------------------------------------------------------
2a2zB           VARWCNVQSTNVL---------------------------------------------------------
1dekA           PIKDALAYAWGVFAANTDYP--LTRKEFEG---IDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVF
421pA           EDSYRKQVVIDGETCL-LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKD
3dt4A           DIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFT----NVAETSDGGVYWEGIDEP
2d4hB           VLLDTEGLGQNDSWI-------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3do6A           LREPS-----------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3bgwA           HSLE------------------------------------------------------------------
2dr3F           VALE------------------------------------------------------------------
1e9rD           VDPNGDMLSKFGR---------------------------------------------------------
1bmfC           KKKLYCIYVAIGQKRSTVAQLVK-----------------------------------------------
3cr7A           RLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPF-
3d7wA           NQSYFLS---------------------------------------------------------------
2d4hA           QKGIWMWCVPHPKKP-------------------------------------------------------
2a30A           VARWCNVQS-------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1cr1A           SVEET-----------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2dr3C           VALEEHPVQVRQN---------------------------------------------------------
2dr3D           VALEEHPVQVRQNMA-------------------------------------------------------
2bwjA           LREELASESERSKLIRDIMERGD-----------------------------------------------
1e9fA           LRFPERSTEIGKL---------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1eamA           MLIDGRHHDPILN---------------------------------------------------------
2c9oC           VGSEVYSTEIKKTEVLMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGE-INKVVNKYIDQGIAELVP-
2dflA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3crmA           ALIYRGMDIGTAKPSRELL---------------------------------------------------
3bb1H           EGPRPVM---------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bb1A           EGPRPVMVSRSRAGF-------------------------------------------------------
3cddC           EPIKQGQTVDIGGERVITGYVDDWVPSYDESTITISVSGRDIDYPSGQFNNQTLTQIADIVCKPFIVNTD
2cgtH           EGLKAVAAGMNPM---------------------------------------------------------
2ancF           EQVLATGVDVFLDIDWQGAQQIRQKM--------------------------------------------
2ahvA           DRGISPLAQEGLVKWA-LCGHWGQSP--------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bdtA           IINHVVGGYRPPWES-------------------------------------------------------
2d4uA           STLNGSWVAL------------------------------------------------------------
1dw9A           VGAKLDLDEDSILLLQIPLRGCIDDRIPTDPTYRFYELQVYTLKALVHEKFGDGIISAINFKLDVKKDPE
3cmvE           ----------------------------------------------------------------------
2cckB           REPGGVPTGEEIR---------------------------------------------------------
3dkvA           GDMFRAAMKEETPLGLEAKSYIDKGELVP-----------------------------------------
3di4A           FSGKTRALHGTHVTTGE-----------------------------------------------------
2dpyB           IGERGREVKD------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3dtbB           DIAWMKFDAQG-----------------------------------------------------------
3a00B           STTRTPRAGEVNG---------------------------------------------------------
1e6cA           FMQHTSGMTVADV---------------------------------------------------------
1e2gA           LRFP------------------------------------------------------------------
2dpyA           IGERGREVKDFI----------------------------------------------------------
3cr7B           RLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPV
3adkA           LLRAEVSSGSARGKMLSEIMEK------------------------------------------------
1e3aB           DWKGLLPFEMNPKVY-------------------------------------------------------
3d3qA           QVYQGD----------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3d3qB           QVYQGD----------------------------------------------------------------
1e1qB           KKKLYCIYVAIGQKR-------------------------------------------------------
3dt7A           DIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLA--
2dr3B           VALEEH----------------------------------------------------------------
3dt4C           DIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPG
1cjvC           IKNNLKEAIETIV---------------------------------------------------------
3bb1D           EGPRPVMVSRSRAGF-------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3dfdA           ETTVYPTFKAKELREAYKTE-DPVEVAKR-----------------------------------------
3cueF           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3a00A           STTRTPRAGEVNGKDYNFV---------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3cmxA           IDAEHALDPIYARKLGVDI---------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bjbA           DGDQARGRPIAPLLDA--LRELGVAVDGTGL----PFRVRGNGS--------------------------
1ai4B           ----------------------------------------------------------------------
2ck3C           KKKLYCIYVAIGQ---------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e9sK           VDPNGDMLSKFGRDKD------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3bczC           AGYTYCGSCAA-----------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2jB           EPMTYWRVLGASETIANIY---------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1e2iA           ETIANIYTTQHRL---------------------------------------------------------
3cioD           IDADLRRGYSHNLFT-------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dvlD           TFEETPQDIIKNARSFG-----------------------------------------------------
1e2hB           EPMTYWRVLGASETIANIY---------------------------------------------------
3cddD           PIKQGQACTVDIGGE--RVITGYVDDWVPGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGVNTD
3cnnA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2kB           EPMTYWRV-LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHA--
3cd9A           QQNTPIGDGPVLL-PDNHYLSTC-----------------------------------------------
1e59A           KEEGYSFDFAYTSVL-------------------------------------------------------
1dvrA           MLRSQIAKGTQLG---------------------------------------------------------
1accA           QGKDITEFDF------------------------------------------------------------
3be4A           MLREAIKNGIGLEAKSIIESGNFVGDEIV-----------------------------------------
1e2hA           -WRVLGASETIANIYTTQHRLDQ-----------------------------------------------
1e2jA           GASETIANIYTTQHR-------------------------------------------------------
1e2lA           VLGASETIANI-----------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
1d6aA           FNPNPKVLN-------------------------------------------------------------
1e2iB           EPMTY-----------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1e3mA           RITEGRHPVVEQVLNEPFI--ANPLNLSPQR---------------------------------------
1dapA           FGRAAHRMKQQGQ---------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2bhjA           DTLHHKATSCLGSNPKSLTRGPRDKPTPLEELLPHAIEFINYYGSFKEAKIEEHLARLEAVTKEIETTGT
2ax4B           DGDNV-----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YLDRELGVGFSGGXXXXXXXXXXXXXXXXXXXXXXTDSGLDVDALGVVSRGIDAYRRATGGALVVITHNT
3c95A           ----------------------------------------------------------------------
2d3wB           LLTRSVNVGFSGG---------------------------------------------------------
2dwoA           FK--------------------------------------------------------------------
3b5jA           -IVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMH--KICKGRTVIIIAHRL
1e9sG           KK--------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2akaB           MTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQ--GQRTIGVITK-
1e9rA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dmdC           KPNLVI----------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dwpA           FK--------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2ctsA           TMLDNFPTNLHPM---------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2czvA           ALGFNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLG----VVIGMEIPQAKASE
1d1cA           ERNYHIFYQLLAG---------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3cmvH           EGEIGDLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIG-AVKEGENVVGSETRV
2awoA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
3b60A           I--GENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK--NRTSLVIAHRL
2d62A           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1e9dA           KE--------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1bifA           YK--------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
3bpbA           RQ--------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
2a5gA           ILIFNKQDLPDAM---------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e4yA           VL--------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2b8tA           NGFVNFKGEPFGPIAKLFTYADKITKLTAI-------CNECGAEATHSLRKIDGKHADYNDDIVKIGCQE
2d3wD           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3eiuA           DLATERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVA------RELHRKGIYPPINV-
1e9sD           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1e2dA           --VAFTGAKENFS---------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2a30B           CMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYGIPLEYLEKLHYKHESWLLHRTLK-
1dg3A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2a2zD           CMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYGIPLEYLEKLHYKHESWLLHRTLK-
2cckA           ----------------------------------------------------------------------
2ccgB           YIDSSLA-YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKVIEG
3b2qB           ----------------------------------------------------------------------
1e98A           KE--------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
2a30D           CMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIQGIPLEYLEKLHYKHESWLLHRTLKT
3bb1F           ----------------------------------------------------------------------
2eg5G           GLV-------------------------------------------------------------------
2bifA           YK--------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           DYGPSSG-SAGSS---------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2axpA           RLRVRGDEYIEGKDIDSILELYREVSNAGLHTYSWDTGQWSSDEI-------------------------
1cr0A           ----------------------------------------------------------------------
3dt2A           LAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWGVPIEGIIFGGRRPAGVPLVYEALS-
3cmtD           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3a1wA           ILEMEKKVILAMT---------------------------------------------------------
2cjwB           SDLVRREVSVSEG---------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
1dekA           VFDDE-----------------------------------------------------------------
421pA           SDDVVLVGNKCDL---------------------------------------------------------
3dt4A           LAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWGVPIEGIIFGGRRPAGVPLVYEALS-
2d4hB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2c9oC           -GVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRT--
2dflA           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3cddC           VGEPFQRIQIEQG---------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1dw9A           GGERTL----DGK---------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3cr7B           YVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPE---VHVKNYELPVQDAVKQIIDYLDTK
3adkA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3dt7A           --PGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWGVPIEGIIFGGRRPAGVPLVYEALSW
2dr3B           ----------------------------------------------------------------------
3dt4C           VTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGRRPAGVPLVYEALS-
1cjvC           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3cddD           VGEPFQRIQIEQGETPHELLARLAKQRGVLLTSDTFG-NLVITRASKT---KAGVSLILGDNVKAARGRF
3cnnA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2bhjA           Y--QLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAIT-
2ax4B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RILExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c95A           ------------------------------------------------------
2d3wB           ------------------------------------------------------
2dwoA           ------------------------------------------------------
3b5jA           STVK--------------------------------------------------
1e9sG           ------------------------------------------------------
2akaA           ------------------------------------------------------
2c61B           ------------------------------------------------------
2awnA           ------------------------------------------------------
2bc9A           ------------------------------------------------------
1e9sB           ------------------------------------------------------
3cmvA           ------------------------------------------------------
2akaB           ------------------------------------------------------
1e9rA           ------------------------------------------------------
2c03B           ------------------------------------------------------
3dmdC           ------------------------------------------------------
3b85A           ------------------------------------------------------
3czpB           ------------------------------------------------------
1e9sF           ------------------------------------------------------
1e9sL           ------------------------------------------------------
2c9gA           ------------------------------------------------------
1e9sM           ------------------------------------------------------
2dwpA           ------------------------------------------------------
1cr4A           ------------------------------------------------------
2ctsA           ------------------------------------------------------
2b92B           ------------------------------------------------------
2dr3E           ------------------------------------------------------
2b8wA           ------------------------------------------------------
1e0jA           ------------------------------------------------------
2c03A           ------------------------------------------------------
4dcgA           ------------------------------------------------------
1e9rF           ------------------------------------------------------
3cmvG           ------------------------------------------------------
2dr3A           ------------------------------------------------------
2awnD           ------------------------------------------------------
2c04A           ------------------------------------------------------
2czvA           IILK--------------------------------------------------
1d1cA           ------------------------------------------------------
3cmvC           ------------------------------------------------------
3d31A           ------------------------------------------------------
1cs4C           ------------------------------------------------------
1cjtC           ------------------------------------------------------
2awoC           ------------------------------------------------------
1e9sE           ------------------------------------------------------
3cmvH           KVVK--------------------------------------------------
2awoA           ------------------------------------------------------
3dm5A           ------------------------------------------------------
3eiuB           ------------------------------------------------------
1culC           ------------------------------------------------------
2awnB           ------------------------------------------------------
1e9sH           ------------------------------------------------------
3dhwC           ------------------------------------------------------
3c15C           ------------------------------------------------------
3cmwC           ------------------------------------------------------
1e69A           ------------------------------------------------------
3bgwD           ------------------------------------------------------
3czpA           ------------------------------------------------------
3cr7C           ------------------------------------------------------
1e0jB           ------------------------------------------------------
2d3wC           ------------------------------------------------------
1b0uA           ------------------------------------------------------
1e9sJ           ------------------------------------------------------
2awoD           ------------------------------------------------------
3b60A           STIE--------------------------------------------------
2d62A           ------------------------------------------------------
2ccjB           ------------------------------------------------------
3dm9B           ------------------------------------------------------
1e9rG           ------------------------------------------------------
2d2eA           ------------------------------------------------------
1e9dA           ------------------------------------------------------
1azsC           ------------------------------------------------------
2bbsA           ------------------------------------------------------
1d6jB           ------------------------------------------------------
1bifA           ------------------------------------------------------
1ckvA           ------------------------------------------------------
3dmdB           ------------------------------------------------------
3bo6B           ------------------------------------------------------
2c61A           ------------------------------------------------------
3c7kA           ------------------------------------------------------
3bpbA           ------------------------------------------------------
3da4A           ------------------------------------------------------
3cm0A           ------------------------------------------------------
3ch4B           ------------------------------------------------------
2a5gA           ------------------------------------------------------
3cmuA           ------------------------------------------------------
1e4yA           ------------------------------------------------------
2d2fA           ------------------------------------------------------
2d3wA           ------------------------------------------------------
3b2qA           ------------------------------------------------------
2b8tA           FYSA--------------------------------------------------
2d3wD           ------------------------------------------------------
2ccgA           ------------------------------------------------------
1e9sI           ------------------------------------------------------
2bbsB           ------------------------------------------------------
3e8aC           ------------------------------------------------------
3eiuA           ------------------------------------------------------
1e9sD           ------------------------------------------------------
2cvfA           ------------------------------------------------------
2d7vA           ------------------------------------------------------
3cr7D           ------------------------------------------------------
1e2dA           ------------------------------------------------------
2d7vB           ------------------------------------------------------
2c9yA           ------------------------------------------------------
1e9rB           ------------------------------------------------------
3ed8A           ------------------------------------------------------
2a2zA           ------------------------------------------------------
2bkiA           ------------------------------------------------------
1e9cA           ------------------------------------------------------
3bh0A           ------------------------------------------------------
2axnA           ------------------------------------------------------
2a30B           ------------------------------------------------------
1dg3A           ------------------------------------------------------
1cr2A           ------------------------------------------------------
2ahwD           ------------------------------------------------------
1e9sA           ------------------------------------------------------
3cmvB           ------------------------------------------------------
2a2zD           ------------------------------------------------------
2cckA           ------------------------------------------------------
2ccgB           YQEI--------------------------------------------------
3b2qB           ------------------------------------------------------
1e98A           ------------------------------------------------------
3clvA           ------------------------------------------------------
1afrA           ------------------------------------------------------
1bg0A           ------------------------------------------------------
2b8wB           ------------------------------------------------------
1cjuC           ------------------------------------------------------
1d2zD           ------------------------------------------------------
2a30D           ------------------------------------------------------
3bb1F           ------------------------------------------------------
2eg5G           ------------------------------------------------------
2bifA           ------------------------------------------------------
3d3kA           ------------------------------------------------------
1dkiA           ------------------------------------------------------
2ancB           ------------------------------------------------------
1ek0A           ------------------------------------------------------
3b9qA           ------------------------------------------------------
3bb1G           ------------------------------------------------------
1e2kA           ------------------------------------------------------
2axpA           ------------------------------------------------------
1cr0A           ------------------------------------------------------
3dt2A           ------------------------------------------------------
3cmtD           ------------------------------------------------------
2bkhA           ------------------------------------------------------
2anbA           ------------------------------------------------------
3a1wA           ------------------------------------------------------
2cjwB           ------------------------------------------------------
3bb1C           ------------------------------------------------------
3c14C           ------------------------------------------------------
2a2zB           ------------------------------------------------------
1dekA           ------------------------------------------------------
421pA           ------------------------------------------------------
3dt4A           ------------------------------------------------------
2d4hB           ------------------------------------------------------
2cbzA           ------------------------------------------------------
3do6A           ------------------------------------------------------
3c8uA           ------------------------------------------------------
3bgwA           ------------------------------------------------------
2dr3F           ------------------------------------------------------
1e9rD           ------------------------------------------------------
1bmfC           ------------------------------------------------------
3cr7A           ------------------------------------------------------
3d7wA           ------------------------------------------------------
2d4hA           ------------------------------------------------------
2a30A           ------------------------------------------------------
2b8tD           ------------------------------------------------------
2ancD           ------------------------------------------------------
1cr1A           ------------------------------------------------------
2an9A           ------------------------------------------------------
2dr3C           ------------------------------------------------------
2dr3D           ------------------------------------------------------
2bwjA           ------------------------------------------------------
1e9fA           ------------------------------------------------------
2bbtA           ------------------------------------------------------
2bbtB           ------------------------------------------------------
1eamA           ------------------------------------------------------
2c9oC           ------------------------------------------------------
2dflA           ------------------------------------------------------
1e9rE           ------------------------------------------------------
3crmA           ------------------------------------------------------
3bb1H           ------------------------------------------------------
2bkeA           ------------------------------------------------------
2bboA           ------------------------------------------------------
1d6jA           ------------------------------------------------------
1e2fA           ------------------------------------------------------
3bb1A           ------------------------------------------------------
3cddC           ------------------------------------------------------
2cgtH           ------------------------------------------------------
2ancF           ------------------------------------------------------
2ahvA           ------------------------------------------------------
3bb1E           ------------------------------------------------------
2bdtA           ------------------------------------------------------
2d4uA           ------------------------------------------------------
1dw9A           ------------------------------------------------------
3cmvE           ------------------------------------------------------
2cckB           ------------------------------------------------------
3dkvA           ------------------------------------------------------
3di4A           ------------------------------------------------------
2dpyB           ------------------------------------------------------
3cnlA           ------------------------------------------------------
3dtbB           ------------------------------------------------------
3a00B           ------------------------------------------------------
1e6cA           ------------------------------------------------------
1e2gA           ------------------------------------------------------
2dpyA           ------------------------------------------------------
3cr7B           GYL---------------------------------------------------
3adkA           ------------------------------------------------------
1e3aB           ------------------------------------------------------
3d3qA           ------------------------------------------------------
3cqcA           ------------------------------------------------------
3d3qB           ------------------------------------------------------
1e1qB           ------------------------------------------------------
3dt7A           QHGV--------------------------------------------------
2dr3B           ------------------------------------------------------
3dt4C           ------------------------------------------------------
1cjvC           ------------------------------------------------------
3bb1D           ------------------------------------------------------
3brwA           ------------------------------------------------------
3dfdA           ------------------------------------------------------
3cueF           ------------------------------------------------------
2b8tC           ------------------------------------------------------
3bwdD           ------------------------------------------------------
2awnC           ------------------------------------------------------
3a00A           ------------------------------------------------------
3dmdA           ------------------------------------------------------
3cmxA           ------------------------------------------------------
3cddB           ------------------------------------------------------
2bjbA           ------------------------------------------------------
1ai4B           ------------------------------------------------------
2ck3C           ------------------------------------------------------
1av6A           ------------------------------------------------------
1e9sK           ------------------------------------------------------
1ak2A           ------------------------------------------------------
3b85B           ------------------------------------------------------
3bb1B           ------------------------------------------------------
3bczC           ------------------------------------------------------
2ccjA           ------------------------------------------------------
1e2jB           ------------------------------------------------------
2bwjB           ------------------------------------------------------
1akeA           ------------------------------------------------------
1e2iA           ------------------------------------------------------
3cioD           ------------------------------------------------------
2b8tB           ------------------------------------------------------
3dvlD           ------------------------------------------------------
1e2hB           ------------------------------------------------------
3cddD           SWRQ--------------------------------------------------
3cnnA           ------------------------------------------------------
3e70C           ------------------------------------------------------
1e2kB           ------------------------------------------------------
3cd9A           ------------------------------------------------------
1e59A           ------------------------------------------------------
1dvrA           ------------------------------------------------------
1accA           ------------------------------------------------------
3be4A           ------------------------------------------------------
1e2hA           ------------------------------------------------------
1e2jA           ------------------------------------------------------
1e2lA           ------------------------------------------------------
3dm5B           ------------------------------------------------------
1d6aA           ------------------------------------------------------
1e2iB           ------------------------------------------------------
1e2mB           ------------------------------------------------------
1e3mA           ------------------------------------------------------
1dapA           ------------------------------------------------------
2bwjD           ------------------------------------------------------
3dlbB           ------------------------------------------------------
2bhjA           ------------------------------------------------------
2ax4B           ------------------------------------------------------