[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56840.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bmbA.bssp"
#ERROR : Can't open dsspfile "1ad1A.bssp"
#ERROR : Can't open dsspfile "1aj0A.bssp"
#ERROR : Can't open dsspfile "1ad4A.bssp"
#ERROR : Can't open dsspfile "1cbkA.bssp"
#ERROR : Can't open dsspfile "3dz1A.bssp"
#ERROR : Can't open dsspfile "2dzaA.bssp"
#ERROR : Can't open dsspfile "2dzbB.bssp"
#ERROR : Can't open dsspfile "2dzaB.bssp"
#ERROR : Can't open dsspfile "1ad4B.bssp"
#ERROR : Can't open dsspfile "2dzbA.bssp"
#ERROR : Can't open dsspfile "3b8pE.bssp"
#ERROR : Can't open dsspfile "3bofA.bssp"
#ERROR : Can't open dsspfile "3di0A.bssp"
#ERROR : Can't open dsspfile "2e7fA.bssp"
#ERROR : Can't open dsspfile "2dqwA.bssp"
#ERROR : Can't open dsspfile "3bolA.bssp"
#ERROR : Can't open dsspfile "2dqwB.bssp"
#ERROR : Can't open dsspfile "3bq6B.bssp"
#ERROR : Can't open dsspfile "3eb2D.bssp"
#ERROR : Can't open dsspfile "3bq6A.bssp"
#ERROR : Can't open dsspfile "3bq5B.bssp"
#ERROR : Can't open dsspfile "3di1B.bssp"
#ERROR : Can't open dsspfile "1ad1B.bssp"
#ERROR : Can't open dsspfile "3bolB.bssp"
#ERROR : Can't open dsspfile "3bq5A.bssp"
#ERROR : Can't open dsspfile "3c0jA.bssp"
#ERROR : Can't open dsspfile "3d0cB.bssp"
#ERROR : Can't open dsspfile "2ehhA.bssp"
#ERROR : Can't open dsspfile "3bofB.bssp"
#ERROR : Can't open dsspfile "3e96B.bssp"
#ERROR : Can't open dsspfile "3d0cA.bssp"
#ERROR : Can't open dsspfile "2cg8A.bssp"
#ERROR : Can't open dsspfile "2ehhC.bssp"
#ERROR : Can't open dsspfile "2a6nA.bssp"
#ERROR : Can't open dsspfile "2cg8D.bssp"
#ERROR : Can't open dsspfile "3daqA.bssp"
#ERROR : Can't open dsspfile "3bi8A.bssp"
#ERROR : Can't open dsspfile "2clhA.bssp"
#ERROR : Can't open dsspfile "3di1A.bssp"
#ERROR : Can't open dsspfile "2cliA.bssp"
#ERROR : Can't open dsspfile "3denA.bssp"
#ERROR : Can't open dsspfile "1a5bA.bssp"
#ERROR : Can't open dsspfile "3di0B.bssp"
#ERROR : Can't open dsspfile "3e96A.bssp"
#ERROR : Can't open dsspfile "1a50A.bssp"
#ERROR : Can't open dsspfile "2clfA.bssp"
#ERROR : Can't open dsspfile "3eb2A.bssp"
#ERROR : Can't open dsspfile "3eb2B.bssp"
#ERROR : Can't open dsspfile "2cg8C.bssp"
#ERROR : Can't open dsspfile "1a5sA.bssp"
#ERROR : Can't open dsspfile "2cg8B.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "2cw6F.bssp"
#ERROR : Can't open dsspfile "2cleA.bssp"
#ERROR : Can't open dsspfile "2a0nA.bssp"
#ERROR : Can't open dsspfile "2a6lA.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "3bliA.bssp"
#ERROR : Can't open dsspfile "3b4uA.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1beuA.bssp"
#ERROR : Can't open dsspfile "1bksA.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "3bpwB.bssp"
#ERROR : Can't open dsspfile "2ebfX.bssp"

## Summary of PDB Search
:435
    4e-53  31%  2bmbA  [x.x.x] FOLIC ACID SYNTHESIS PROTEIN FOL1
    1e-51  42%  1ad1A  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    3e-40  47%  1aj0A  [x.x.x] DIHYDROPTEROATE SYNTHASE
    9e-38  40%  1ad4A  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    1e-35  38%  1cbkA  [d.58.30] PROTEIN (7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-
    3e-31  15%  3dz1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-30  42%  2dzaA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-30  43%  2dzbB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-30  43%  2dzaB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    2e-29  39%  1ad4B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    3e-29  42%  2dzbA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    9e-29   9%  3b8pE  [x.x.x] CHAIN LENGTH DETERMINANT PROTEIN
    1e-28  18%  3bofA  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    3e-28  13%  3di0A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    5e-28  16%  2e7fA  [x.x.x] 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFUR
    1e-27  41%  2dqwA  [x.x.x] DIHYDROPTEROATE SYNTHASE
    1e-27  17%  3bolA  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    2e-27  41%  2dqwB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    9e-27  12%  3bq6B  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-26  12%  3eb2D  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    5e-26  12%  3bq6A  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-25  13%  3bq5B  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    5e-25  11%  3di1B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    8e-25  39%  1ad1B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
    2e-24  15%  3bolB  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    3e-24  11%  3bq5A  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    6e-23  12%  3c0jA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-21  11%  3d0cB  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    7e-21  14%  2ehhA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-20  16%  3bofB  [x.x.x] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE
    2e-20  15%  3e96B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-20  12%  3d0cA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-18  41%  2cg8A  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    2e-18  12%  2ehhC  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-18  14%  2a6nA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    7e-18  40%  2cg8D  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    7e-18  11%  3daqA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-17  11%  3bi8A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    7e-16  12%  2clhA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-15   9%  3di1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-15  12%  2cliA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-15  11%  3denA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-14  13%  1a5bA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    3e-13  15%  3di0B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    9e-12  14%  3e96A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-11  14%  1a50A  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    2e-11  16%  2clfA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-11  12%  3eb2A  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    5e-11  13%  3eb2B  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    9e-11  39%  2cg8C  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    3e-10  11%  1a5sA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    1e-09  34%  2cg8B  [x.x.x] DIHYDRONEOPTERIN ALDOLASE 6-HYDROXYMETHYL-7,8-
    3e-08   6%  2csbA  [x.x.x] TOPOISOMERASE V
    1e-07  16%  2cw6F  [x.x.x] HYDROXYMETHYLGLUTARYL-COA LYASE, MITOCHONDRIAL
    4e-07  13%  2cleA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-06  11%  2a0nA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    5e-06  13%  2a6lA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-06  16%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    9e-06  13%  3bliA  [x.x.x] CITRAMALATE SYNTHASE FROM LEPTOSPIRA INTERROGANS
    1e-05  21%  3b4uA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    9e-05  17%  1efzA  [c.1.20] TRNA-GUANINE TRANSGLYCOSYLASE
    1e-04  12%  1beuA  [c.1.2] TRYPTOPHAN SYNTHASE
    1e-04  13%  1bksA  [c.1.2] TRYPTOPHAN SYNTHASE
    5e-04  14%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    6e-04  10%  3bpwB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    0.001  12%  2ebfX  [x.x.x] DERMONECROTIC TOXIN
:435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS
2bmbA           FKTATKTNRITVSPTYIMAIFNATPDSFSDGGEHQLNDIIKLCKDALYLHESVIIDVGGCSTRPNSIQAS
1ad1A           --------------TKIMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMIT
1aj0A           ---FAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVS
1ad4A           --------------TKIMGILNVNVESA------------VTRVKAMMDEGADIIDVGGVSTRPGHEMIT
1cbkA           ----------------------------------------------------------------------
3dz1A           -----------KLTPEAAGTFAIAPTPFHDDGKID-DVSIDRLTDFYAEVGCEGVTVLGILGEAPK--LD
2dzaA           ----------------LLGVLNLT-------------PRALERAREMVAEGADILDLGAESLLPVLEAV-
2dzbB           ----------------LLGVLNLTPD----------PERALERAREMVAEGADILDLGAESTPV------
2dzaB           ----------------LLGVLNLTPD------------SALERAREMVAEGADILDLGAESTRPPVPVEE
1ad4B           --------------TKIMGILNVTN-----------VESAVTRVKAMMDEGADIIDVGGVMITV------
2dzbA           ----------------LLGVLNLT-------------PRALERAREMVAEGADILDLGAESE--------
3b8pE           ----------------------ITQPDAAQVATYTNALNVLYGGN-APKISEVQANFISRAFSALSEVLD
3bofA           --------------KLVFGDIGPTGELPYPLGSEEFYENFRETVEIMVEEGVDGIIFETFSDILELAAVL
3di0A           --------------HLFEGVGVALTTPFTNNK--VNIEALKTHVNFLLENNAQAIIVNGTTAESPTLTT-
2e7fA           -------------MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQ------
2dqwA           ----------------LLGVLNLT-------------PRALERAREMVAEGADILDLGAE----------
3bolA           ----------------VFGDIGPTGELPYPLGSTLFYENFRETVEIMVEEGVDGIIFETFSILELKAAVL
2dqwB           ------------------------------------PERALERAREMVAEGADILDLGAESPVEE-----
3bq6B           ---------MLTGPVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEPAFREKAKKSK
3eb2D           ----------------FHGVFPYLVSPVDAEGRVR-ADVMGRLCDDLIQAGVHGLTPLG---STGEFAYL
3bq6A           --------------PVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEGIKIVQIDEPAFREKAPISK
3bq5B           --------------PVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEGIKIVQIDEPAFREKAKKSK
3di1B           -------------THLFEGVGVALTTPFTNNK--VNIEALKTHVNFLLENNAQAIIVNGTTAESPTLTT-
1ad1B           -----------TKTK-IMGILNVTPNV----------ESAVTRVKAMMDEGADIIDVGGVSTMITVEE--
3bolB           VSSPSKLVTFDHFVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQ------
3bq5A           ----------------IMSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEPAFRAPIKKSK
3c0jA           ---------------MFTGSIVAIVTPMDEKGNVC-RASLKKLIDYHVASGTSAIVSVG---TTGESATL
3d0cB           ----------GEFSKRFSTISGINIVPFLEGTREIDWKGLDDNVEFLLQNGIEVIVPNG--NTGEFYALT
2ehhA           ---------------MFQGSIVALITPFKEGE--VDYEALGNLIEFHVDNGTDAILVCG---TTGESPTL
3bofB           ----------DHFVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYV
3e96B           -------------AKALETISGIPITPFRKSDGSIDWHHYKETVDRIVDNGIDVIVPCGNTSEFYA--LS
3d0cA           -------------SKRFSTISGINIVPFLEGTREIDWKGLDDNVEFLLQNGIEVIVPNG--NTGEFYALT
2cg8A           ----------------------------------------------------------------------
2ehhC           ------------------GSIVALITPFKEGE--VDYEALGNLIEFHVDNGTDAILVCG---TTGESPTL
2a6nA           ---------------MFTGSIVAIVTPMDEKGNVC-RASLKKLIDYHVASGTSAIVSVG---TTGESATL
2cg8D           ----------------------------------------------------------------------
3daqA           --------------HLFEGVGVALTTPFTNNK--VNLEALKAHVNFLLENNAQAIIVNGTTAESPTLTTD
3bi8A           ---------------IFKGSGVAIITPFTNTGVD--FDKLSELIEWHIKSKTDAIIVCGTTGEATTMTET
2clhA           ----------------LNDRREGAFVPFVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLADGPT
3di1A           --------------HLFEGVGVALTTPFTNNK--VNIEALKTHVNFLLENNAQAIIVNGTTAESPTLTTD
2cliA           ---------------------EGAFVPFVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLADGPT
3denA           ---------------MFTGSIVAIVTPMDEKGNVC-RASLKKLIDYHVASGTSAIVSV--GTTGESATLN
1a5bA           ----------------LNDRREGAFVPFVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLANGPT
3di0B           --------------HLFEGVGVALTTPFTNNK--VNIEALKTHVNFLLENNAQAIIVNG---TTAESPTL
3e96A           -------------AKALETISGIPITPFRKSDGSIDWHHYKETVDRIVDNGIDVIVPCG-NTSEF-YALS
1a50A           ---------------------------FVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLADGPT
2clfA           ---------------------EGAFVPFVTLG-DPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPT
3eb2A           -----------------HGVFPYLVSPVDAEGRVR-ADVMGRLCDDLIQAGVHGLTPLG---STGEFAYL
3eb2B           ----------------FHGVFPYLVSPVDAEGRVR-ADVMGRLCDDLIQAGVHGLTPLG---STGEFAYL
2cg8C           ----------------------------------------------------------------------
1a5sA           ---------------------EGAFVPFVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLARAFA
2cg8B           ----------------------------------------------------------------------
2csbA           -----RYLERSSSAKNDEELLELHQNFILLTGSYA--CSIDPTEDRYQNVIVRGVNFDETGGSPARYAIV
2cw6F           --------------------------GCPYEGKIS-PAKVAEVTKKFYSMGCYEISLGD--TIGVGTPGI
2cleA           ---------------LFAQLNDRREGAFFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPT
2a0nA           -------------------------------------GDPVELGKFYSEIGIDELVFLDITASVEKRKTM
2a6lA           ---------------MFTGSIVAIVTPMDEKGNVC-RASLKKLIDYHVASGTSAIVSVG---TTGESATL
1b3oB           -----------------------------NLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEV
3bliA           PKEFFTDVSFVIEYAIKSGLKINVYLEDWSNGFRNSPDYVKSLVEHLSKEHIERIFLPDTL--GVLSPEE
3b4uA           ------------------GLSAALTTPFKTDGTVD-IDAMIAHARRCLSNGCDSVTLFG---TTGEGCSV
1efzA           -------------------------------------NLRQQSADALAEIGFDGYAVGGLAVGEG-----
1beuA           ---------------QLNDRREGAFVPFVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLANGPT
1bksA           ---------------QLNDRREGAFVPFVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLADGPT
1ak5A           ------------------------------------------GFRYLADAGADFIKIGIGRGQATAVIDV
3bpwB           ------------------------------------------MAQEALNMSSYLNLEQNNEFVVGANSYD
2ebfX           ---------------------------------------FADSSLLNSTPGRPMPGL--VQYLK------


                         .         .         *         .         .         .         .:140
query           VDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLVVMHM
2bmbA           EEEEIRRSIPLIKAIRESKVILSIDTYRSNVAKEAIKVGVDIINDISGGLDSNMFVIAENPEICYILSHT
1ad1A           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGYDHRMFQVVAKYDAEIVLMHN
1aj0A           VEEELQRVIPVVEAIAQREVWISVDTSKPEVIRESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHM
1ad4A           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGYDHRMFQVVAKYDAEIVLMHN
1cbkA           ----------------------------------------------------------------------
3dz1A           AAEAEAVATRFIKRAKQVIVGVSAPGFAARRLARLSDAGAAGVIAPPPSLDEQITTYFRGDDVPWVLQDY
2dzaA           ---------------LSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
2dzbB           -EEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
2dzaB           ---EKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
1ad4B           -EEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGYDHRMFQVVAKYDAEIVLMHN
2dzbA           --EEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARGVAAVVMHMP
3b8pE           NQKEREKLTIEQSVKGQAPLSVSYVSTTAEGAQRRLAEYIQQVDEEVAKEKDNITLQTKTLQESLETQEV
3bofA           AAREVSRDVFLIAHMTFEKGRSLTGTDPANFAITFDELDIDALGINCSLGLPIFQELSQYTDKFLVVEPN
3di0A           --DEKERILKTVIDLVDKRVPVIAGTGTIQASIQAKALGADAIMLITPYYNKTNQRGLVKVKLPVVLYNV
2e7fA           --DKVSAMEWLVEVTQEVTLCLDSTNIKAIEAGLKKCKNRAMINSTNAERKVEKLFPLAVEHGAALIGL-
2dqwA           -EEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGRDERMVALAARHGVAAVVMHMP
3bolA           AAREVSRDVFLIAHMFDEKGRSLTGTDPANFAITFDELDIDALGINCSLGLPIFQELSQYTDKFLVVEPN
2dqwB           ---EKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM
3bq6B           WPEYFEWAINAFNLAARPETQIHAHMDFNEIIEYIHQLEFDVISIEASRSKGEIISAFENKGWIKQIGVG
3eb2D           GTAQREAVVRATIEAAQRRVPVVAGVASVAQAKLYEKLGADGILAILEAYFPLKDAQIES--YFRAIADA
3bq6A           WPEYFEWAINAFNLAARPETQIHAHMCYNEIIEYIHQLEFDVISIEASRSKGEIISAFENFKGWIKQIGV
3bq5B           WPEYFEWAINAFNLAANARPETQIHAHMNEIIEYIHQLEFDVISEASRSKGEIISAFENFKGWIKQIGVG
3di1B           --DEKERILKTVIDLVDKRVPVIAGTGTIQASIQAKALGADAIMLITPYYNKHFEAIADAVKLPVVLYNV
1ad1B           ---ELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGYDHRMFQVVAKYDAEIVLMHN
3bolB           -IDVRYVEKIVQTLPYVSNVPLSLDIQNVDLTERALRAYPSLFNSAKVDEEELEMKIN-------LLKKY
3bq5A           WPEYFEWAINAFNLAANAETQIHAHSDFNEIIEYIHQLEFDVISIEASRSKGEIISAFEN----FKGWIK
3c0jA           NHDEHADVVMMTLDLADGRIPVIAGTEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTD
3d0cB           IEEAKQVATRVTELVNAGIGYSVDTAIELGKSAIDSGADCVIHQPVHPYTDAGAVEYYRNLDAPSIIYFK
2ehhA           TFEEHEKVIEFAVKRAAGRIKVIAGTGGVHLTAHAKEVGADGALVVVPYYNKPTQRGLYEHFKT--VAQE
3bofB           EKIV-----QTLPYVSNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEEMKINLLKKYGGTLIVLLM
3e96B           LEEAKEEVRRTVEYVHGRLVVAGIGYATSTAIELGNAAKAAIHMPIHYVTAGGVYAYFRDIIEALDFPSL
3d0cA           IEEAKQVATRVTELVNRATVVAGIGYSVDTAIELGKSADCVIHQPVHPYTDAGAVEYYRNLDAPSIIYFK
2cg8A           ----------------------------------------------------------------------
2ehhC           TFEEHEKVIEFAVKRAAGRIKVIAGTGGVHLTAHAKEVGADGALVVVPYYNEHFKTVAQEVDIPIIIYNI
2a6nA           NHDEHADVVMMTLDLADGRIPVIAGTAEASLTQRFNDSGIVGCLTVTPYYN--RPSQEGLYQHFKAIAEH
2cg8D           ----------------------------------------------------------------------
3daqA           EKELILKTVIDLVDKVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKHFEAIADAVKLPVVLYNV
3bi8A           ERKETIKFVIDKVN-KRIPVIAGTGSNNTAMSKWAESIGVDGLLVITPYYNKHFKAVSDAVSTPIIIYNV
2clhA           IQNANLRAFAALALIREKHPTIPIGLLMYAFYARCEQVGVDLVADVPVEESAPFRQAALRHNIAPIFICP
3di1A           EKERILKTVIDLVDKVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKHFEAIADAVKLPVVLYNV
2cliA           IQNANLRAFAALALIREKHPTIPIGLLMYAFYARCEQVGVDLVADVPVEESAPFRQAALRHNIAPIFICP
3denA           HDEHADVVMMTLDLADGRPVIAGTGANAISLTQRFNDSGIVGCLTVTPYWNRPSQEGLYQHFKAIAEHTD
1a5bA           IQNANLRAFAMLALIREKTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSSAPFRQAALRHNIAPIFICP
3di0B           TTDEKERILKTVIDLVDKRVPVIAGTGTIQASIQAKALGADAIMLITPYYNKHFEAIADAVKLPVVLYNV
3e96A           LEEAKEEVRRTVEYVHGRLVVAGIGYATSTAIELGNAAKAAGADAVMIHM-PIHPYVTAGGVYARDIIEA
1a50A           IQNANLRAFAAGVTPAQPTIPIGLLMYANLVFNNGIDADSVLVADVPVEESAPFRQAALRHNIAPIFICP
2clfA           IQNANLRAFAALALIREKHPTIPIGLGIDAFYARCEQVGVDSVLDVPVEESAPFRQAALRHNIAPIFICP
3eb2A           GTAQREAVVRATIEAAQRRVPVVAGVASVAQAKLYEKLGADGILAILEAYFP--LKDAQIESYFRAIADA
3eb2B           GTAQREAVVRATIEAAQRRVPVVASVADAAQAKLYEKLGADGILAILEAYFP--LKDAQIESYFRAIADA
2cg8C           ----------------------------------------------------------------------
1a5sA           AGVTPAQCFEMLALIREKTIPIGLLMYANAFYARCEQVGVDSVLVAPVEESAPFRQAALRHNIAPIFICP
2cg8B           ----------------------------------------------------------------------
2csbA           YRRGWRAIAKALDIDEEDVPAIEVRAVKRRILVRYGRVDLPVTVDEVPP-EAGEFERLIE----------
2cw6F           MKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQMGVSVVDSS------------------------
2cleA           IQNANLRAFAAGALIREKHPTIPIGLLMYAFYARCEQVGSVLVADVPVEESAPFRQAALRHNIAPIFICP
2a0nA           LELVEK-----VAEQIDIPFTVGGGIHDFETASELILRGADKVSINTAANPSLITQIAQTFGSQAVVVAI
2a6lA           NHDEHADVVMMTLDLADGRIPVIAGTAEASLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTD
1b3oB           LACGRPQATAVYKVSEYARVIADGGIQNVGHIAKALALGASTVMMGSLLATTEAPGEDKGSIHKFVPYLI
3bliA           TFQGVDSLIQKYP-----DIHFEFNDYDLSVALQAIRAGVKGLHAINGLGNTPLEALVTTIHDKSNS-KT
3b4uA           GSRERQAILSSFIAAGIAPSRIVTGVLVADQSAEALNAGARNILLAPPYFKNVSDDGLF-----------
1efzA           -QDEMFRVLDFSVPMLPDDKHYLMGVGKPDDIVGAVERGIDMFDCVLPTRGRNGQAFTWDGPINIRNARF
1beuA           IQNANLRAFAAGVTPA----------QCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAF---------
1bksA           IQNANLRAFAAGVTPAQCF----------EMLALIREKHPTIPIGLLMYANLVFNNGIDAF---------
1ak5A           VAERNKYF---EETGIYIPVCSDGGIVYDYHMTLALAMGADFIMLGRYFEESPTRKVTINGSVMKEYWGE
3bpwB           EMNYIRTYFPNCYILSPGIGAQNGDLHKTLTNGYHKSYEKILINIGRAIKNPYPQKAAQ-----------
2ebfX           IPATV------VDSDGAWQFLPDVASSRVPIEVTELENWQVLTPPLKQFKLTAGFPTEQS----------


                         +         .         .         .         .         *         .:210
query           QGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLG
2bmbA           RGDISTMNRLAHYENLIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGFAKTWKQNLQIIRHIPILKNYS
1ad1A           GN-------GNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
1aj0A           QGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFN
1ad4A           GN-------GNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
1cbkA           ----------------------------------------------------------------------
3dz1A           PLTLSVVTPKVIRQIVDSASCVLKHEDWPGLEKITTLRGFQKDGSLRPLSILCGNGGLFLDFEERGADGA
2dzaA           VPDPATMMAHARYRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKLLEHNLALLRRLDEIVALG
2dzbB           PAHAR-------YRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKLLEHNLALLRRLDEIVALG
2dzaB           PVPPATMMAHARYRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKLLEHNLALLRRLDEIVALG
1ad4B           GNGNR-------DEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
2dzbA           VPDPATMMAHARYRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKLLEHNLALLRRLDEIVALG
3b8pE           V-----------AQEQKDLRIKQIEEAYYQTKQTLLDIKNLKVTATVHVYRYVKPTLPVRRD--------
3bofA           AGKPIVENGKTVYPLKP----HDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRKVLG------------
3di0A           PSRTNMTIEPETVEILSQHPYIVAL--KDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGV
2e7fA           ------TMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPQDHAPEVLKTLQQIKMLADPA
2dqwA           VPDPATMMAHARYRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKLLEHNLALLRRLDEIVALG
3bolA           AGKPIVENGKTVYPLKPHDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRKVLGN---------------
2dqwB           P-----VPAHARYRDVVAEVKAFLEAQARRALSAGV--PQVVLDPGFGFGKLLEHNLALLRRLDEIVALG
3bq6B           VWDIHSPAV-PSINEMREIVERVL---------RVLPKELIWINPDCGLKRNWDEVIPSLRNMVALAKEM
3eb2D           VEIPVVIYTNPQFQRSDLTL-DVIARLAEHPRIRYIKDASTNTGRLLSIINRCGDALQVFSASAHIP-AA
3bq6A           GVWDIHSPAVPSINEMREIVERVL---------RVLPKELIWINPDCGLKTNWDEVIPSLRNMVALAK--
3bq5B           VWDIHSPAV-PSINEMREIVERVL---------RVLPKELIWINPDCGLKRNWDEVIPSLRNMVALAK--
3di1B           PSRTNMTIEP-----------ETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVE
1ad1B           GNGNR-------DEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
3bolB           GGTLIVLLMGKDVPKSFEERKEYFEKALKILERHDFSDR-VIFDPGVLPLGAEGKPVEVLKTIEFISSKG
3bq5A           QIGVGVWDIHSPAVPSINEMREIVERV-----LRVLPKELIWINPDCGLKTNWDEVIPSLRNMVALAK--
3c0jA           LPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLG
3d0cB           DASDDVIKELAPLDKLVGIKYAINDIQRVTQVRAVPKSSNVAFICGTAE-----------KWAPFFYHAG
2ehhA           VDIPIIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGESFSVLSGDDSL-TLP
3bofB           GKD---------VPKSFEERKEYFEKALKILERHDF-SDRVIFDPGVLPLGAEGKPVEVLKTIEFISSKG
3e96B           VYFDRVLVDLAPLQNLVG----------------------------------------------------
3d0cA           DASDDVIKELAPLDKLVGIKYAINDIQRVTQVRAVPKSSNVAFICG-----------TAEKWAPFFYHAG
2cg8A           ----------------------------------------------------------------------
2ehhC           PSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGESFSVLSGDDSLTLMALGAKGVISVA
2a6nA           TDLPQILYNVPSATG-CDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDAS-ALD
2cg8D           ----------------------------------------------------------------------
3daqA           PSRTNMTIEPETVEILSQHPYIVA--LKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGV
3bi8A           PGRTGLNITP-----------GTLKELCEDKNIVAVKEASGNISQIAQIKALCGDKLD-IYSGNDDQIIP
2clhA           PNADDDLLRQV-ASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGI-------------------
3di1A           PSRTNMTIEPETVEIIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQR----GGQGVISVI
2cliA           PNADDDL--LRQVASYGRGYTYLLSRSGVTGHLIEKLKEYHAAPALQGFGI-------------------
3denA           LPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLG
1a5bA           PNADDDLL-----RQVASYGRGYTY------LLIEKLKEYHAAPALQGFGISPEQVSAAVR---------
3di0B           PSRTNMTIEPETVEILS-----------------------------------------------------
3e96A           LDFPSLVYFKDPEISDRVLVDLAPLQNLVGVKYAINDLPRFA----------------------------
1a50A           PNADDDLQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGIS------------------
2clfA           PN---------ADDDLLRQVASYGRGYTYLLSHHLIEKEYHAAPALQGFGI-------------------
3eb2A           VEIPVVIYTNPQFQRSDLTLDVIARLAEHP-RIRYIKDASTNTGRLLSIINRCGDALQVFSASAHIPLIG
3eb2B           VEIPVVIYTNPQFQRSDLTLDV-IARLAEHPRIRYIKDASTNTGRLNRCGDALQVFSASAHIPAAVMLIG
2cg8C           ----------------------------------------------------------------------
1a5sA           PNADDLLRQVASYGRGYTYLLSRSGVTGAENLIEKLK-EYHAAPALQGFGI-------------------
2cg8B           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
2cw6F           ----------------------------------------------------------------------
2cleA           PNAD---------DDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQG--------------------
2a0nA           DAKRVDGEFMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSI--DRDGTKSGYDTEMIRFVRPLTTLP
2a6lA           LPQILYNVPSHTGCDLLPET---VGRLAKVKNIIGIKEATGNLTRVELVSDDFVLLSGDDASALDFMQLG
1b3oB           AGIQHSCQGAKSLTQVRAMMYSGELKFEKRTSSA------------------------------------
3bliA           NINEIAITEASRLVEVFSGKRISANREDVFTQTAGVNLYANPILPE------------------------
3b4uA           ----------------------------------------------------------------------
1efzA           SEDLKPL-DSECHCAVCQKWSRA-----------------------------------------------
1beuA           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
1ak5A           GSSRGVDSYVPYAGKLKDNVEASLNKVKSTMCNCGALT--------------------------------
3bpwB           ----------------------------------------------------------------------
2ebfX           -------RLPLLENSVSEDLREELMQKIDAIKNDVKMNSLVCMEAG------------------------


                         .         .         .         +         .         .         .:280
query           YPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVVRAHNVAATVAALEGLRPYALIGMGCN
2bmbA           FTVLLGPSRKKFIGHITKDVDAKQRDFATGAVVASCIGFGSDMVRVHDVKNCSKSIK-----AFLAFGSN
1ad1A           YPVLLATSRKRFTKEMMGYDTTPVRDEVTAATTAYGIMKGVRAVRVHNVELNAKLAK-------------
1aj0A           LPLLVGMSRKSMIGQLLN-VGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAM--------------
1ad4A           YPVLLATSRKRFTKEMMGYDTTPVRDEVTAATTAYGIMKGVRAVRVHNVELNAKLAK-------------
1cbkA           --------------------------------------------------------------AYIALGSN
3dz1A           TGYCFPDLVDVVKLSKAG-QRDLAHNLFDAHLPLI----RYEHQQGVGLSVRKYVL------KKRGLLQR
2dzaA           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
2dzbB           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREALG-------------
2dzaB           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
1ad4B           YPVLLATSRKRFTKEMMGDTTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAK-------------
2dzbA           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREALG-------------
3b8pE           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
3di0A           ISVIANVIPKEFQAL---YDAQQSGLDIQDQFKPIG-TLLSALSVDINPIPIKALTSYL---GFGNYELR
2e7fA           PKTVLGLSNVSQN--------CQNRPLINRTFLAMAMACGLDAAIADACAATAEILLNQTVYC-------
2dqwA           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREAL--------------
3bolA           ----------------------------------------------------------------------
2dqwB           HPVLVGLSRKRTIGELSGVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREALG-------------
3bq6B           R---------------------------------------------------------------------
3eb2D           VMLIGGVGWMAGPACIAPRQSVALYELCKAQRWDEALMLQRKLWRVNEAFNLAACIAGLALQGYDVGDPI
3bq6A           ----------------------------------------------------------------------
3bq5B           ----------------------------------------------------------------------
3di1B           YYQRGGQGVISVIAVIPKEFQALYDAQQSGLDIQDQFKPIGTLLSALSVDINPIPIALTSYLGFGNYELR
1ad1B           YPVLLATSRKRFTKEMMGYDTTPVRDEVTAATTAYGIMKGVRAVRVHNVELNAKLAK-------------
3bolB           FNTTVGLSNLSFLP---------DRSYYNTAFLVLGISKGLSSAIMNPLDETLMK---------------
3bq5A           ----------------------------------------------------------------------
3c0jA           GHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQMPLHNKLFVEPNPIPVKWAC------KELGLVLR
3d0cB           AVGFTSGLVNVFPQKSFALLEALEEGNQEKIWDVWEDVVPFEDLRAKHNNGNNVVIKEAEQLGLRAGVTR
2ehhA           MMALGAKGVISVANNVMPKELIRAALEGDFRRAREIHYYLHDLFKVLFIETNPIPVKACWMLGMCEKEFR
3bofB           FNTTVGLSNLSFG--------LPDRSYYNTAFLVLGISKGLSSAIMNPLDETLMK---------------
3e96B           ----------------------------------------------------------------------
3d0cA           AVGFTSGLVNVFPQKSFALLEALEEGNQEKIWDVWEDVVPFEDLRAKHNNGNNVVIKEAEQLGLRAGVTR
2cg8A           ----------------------------------------------------------------------
2ehhC           NNVMPREVKELIRAALEGDFRRAREIHYYLHDLFKVLFIETNPIPVK----TACWMLG-----MCEKEFR
2a6nA           FMQLGGHGVISVTADMAQMCKLAAEGHFAEARVINQMPLHNKLFVEPNPIPVKWAC------KELGLVLR
2cg8D           ----------------------------------------------------------------------
3daqA           ISVIANVIPKEFQALYD------AQQSGLDIQDQFKGTLLSALSVDINPIPIKALTSYL---GFGNYELR
3bi8A           ILALGGIGVISVLANVIPEDVHNMCELYLNNEALKIQLDSLALTNALFIETNPIPVTAMNLMNMKVGDLR
2clhA           ----------------------------------------------------------------------
3di1A           ANVIPKEFQALYDAQQSGLDIQDQFKPIGTLLSALSVDINPIPIKA-----------LTSYLGFGNYELR
2cliA           ----------------------------------------------------------------------
3denA           GHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQMPLHNKLFVEPNPIPVKWAC------KELGLVLR
1a5bA           ----------------------------------------------------------------------
3di0B           ----------------------------------------------------------------------
3e96A           ----------------------------------------------------------------------
1a50A           ----------------------------------------------------------------------
2clfA           ----------------------------------------------------------------------
3eb2A           GVGWMAGPACIAPRQSVALYELCKAQRWDEALMLQRWRVNEAFAKFNLAACIKAGLALQ---GYDVGDPI
3eb2B           GVGWMAGPACIAPRQSVALYELCKAQRWDEALMLQRWRVNEAFAKFNLAACIKAGLALQ---GYDVGDPI
2cg8C           ----------------------------------------------------------------------
1a5sA           ----------------------------------------------------------------------
2cg8B           --------------------------------------------------------------------RK
2csbA           ----------------------------------------------------------------------
2cw6F           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2a0nA           IIASGGAG--------------------------------------------------------------
2a6lA           GHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRPLHNKLFVEPNPIPVKWAC------KELGLVLR
1b3oB           ----------------------------------------------------------------------
3bliA           ----------------------------------------------------------------------
3b4uA           ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1beuA           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2ebfX           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELL
2bmbA           I-------GDRF---KHIQMALQLLSREKTVKLRNISSIFESEPMYFKDQTPFMNGCVEVETLLTPSELL
1ad1A           ----------------------------------------------------------------------
1aj0A           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1cbkA           L----------NTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPLKLL
3dz1A           KPGASLTDTARE----------------------------------------------------------
2dzaA           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
2dzaB           ----------------------------------------------------------------------
1ad4B           ----------------------------------------------------------------------
2dzbA           ----------------------------------------------------------------------
3b8pE           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
3di0A           LPLVSLEDTDTKVLRETYDTF-------------------------------------------------
2e7fA           ----------------------------------------------------------------------
2dqwA           ----------------------------------------------------------------------
3bolA           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
3bq6B           ----------------------------------------------------------------------
3eb2D           PPQAALTAEERKAVEKVLAEI-------------------------------------------------
3bq6A           ----------------------------------------------------------------------
3bq5B           ----------------------------------------------------------------------
3di1B           LPLVSLEDTDTKVLRETYDT--------------------------------------------------
1ad1B           ----------------------------------------------------------------------
3bolB           ----------------------------------------------------------------------
3bq5A           ----------------------------------------------------------------------
3c0jA           LPMTPITDSGRETVRAALKHA-------------------------------------------------
3d0cB           EPVNPLSPNDRLELEELLKSW-------------------------------------------------
2ehhA           LPLTEMSPENENKLREVLKKY-------------------------------------------------
3bofB           ----------------------------------------------------------------------
3e96B           ----------------------------------------------------------------------
3d0cA           EPVNPLSPNDRLELEELLKSW-------------------------------------------------
2cg8A           ---------------ANLKQAIDKLRARG-IHILKESSVLAS----------FANQVVEVETWLPAQDLL
2ehhC           LPLTEMSPENENKLREVLKKY-------------------------------------------------
2a6nA           LPMTPITDSGRETVRAALKHA-------------------------------------------------
2cg8D           ------------------------------------------------SVLSFANQVVEVETWLPAQDLL
3daqA           LPLVSLEDTDTKVLREAYDTF-------------------------------------------------
3bi8A           LPLCEMNENNLE----------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3di1A           LPLVSLEDTDTKVLRETYDT--------------------------------------------------
2cliA           ----------------------------------------------------------------------
3denA           LPMTPITDSGRETVRAALKHA-------------------------------------------------
1a5bA           ----------------------------------------------------------------------
3di0B           ----------------------------------------------------------------------
3e96A           ----------------------------------------------------------------------
1a50A           ----------------------------------------------------------------------
2clfA           ----------------------------------------------------------------------
3eb2A           PPQAALTAEERKAVEKVLAE--------------------------------------------------
3eb2B           PPQAALTAEERKAVEKVLAEI-------------------------------------------------
2cg8C           --------------QANLKQAIDKLRA-RGIHILKESSVLAS----------FANQVVEVETWLPAQDLL
1a5sA           ----------------------------------------------------------------------
2cg8B           QRAFIALGSNMGDKQANLKQAIDKLRARGIH-ILKESSVLATDS--------FANQVVEVETWLPAQDLL
2csbA           ----------------------------------------------------------------------
2cw6F           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2a0nA           ----------------------------------------------------------------------
2a6lA           LPMTPITDSGRETVRAALKHA-------------------------------------------------
1b3oB           ----------------------------------------------------------------------
3bliA           ----------------------------------------------------------------------
3b4uA           ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1beuA           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2ebfX           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHVLANDV
2bmbA           KLCKKIEYEELQ---RTIDLDIVMFLNSAGEDIIVNEPDLNIPHPRMLERTFVLEPLCELISPVHL----
1ad1A           ----------------------------------------------------------------------
1aj0A           ----------------------------------------------------------------------
1ad4A           ----------------------------------------------------------------------
1cbkA           DELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPNSQ
3dz1A           ----------------------------------------------------------------------
2dzaA           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
2dzaB           ----------------------------------------------------------------------
1ad4B           ----------------------------------------------------------------------
2dzbA           ----------------------------------------------------------------------
3b8pE           ----------------------------------------------------------------------
3bofA           ----------------------------------------------------------------------
3di0A           ----------------------------------------------------------------------
2e7fA           ----------------------------------------------------------------------
2dqwA           ----------------------------------------------------------------------
3bolA           ----------------------------------------------------------------------
2dqwB           ----------------------------------------------------------------------
3bq6B           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3bq6A           ----------------------------------------------------------------------
3bq5B           ----------------------------------------------------------------------
3di1B           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------
3bolB           ----------------------------------------------------------------------
3bq5A           ----------------------------------------------------------------------
3c0jA           ----------------------------------------------------------------------
3d0cB           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
3bofB           ----------------------------------------------------------------------
3e96B           ----------------------------------------------------------------------
3d0cA           ----------------------------------------------------------------------
2cg8A           ETLLAIESELGRI----------DLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAPHFIH----
2ehhC           ----------------------------------------------------------------------
2a6nA           ----------------------------------------------------------------------
2cg8D           ETLLAIES------ELGRGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAPHFIH----
3daqA           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
2clhA           ----------------------------------------------------------------------
3di1A           ----------------------------------------------------------------------
2cliA           ----------------------------------------------------------------------
3denA           ----------------------------------------------------------------------
1a5bA           ----------------------------------------------------------------------
3di0B           ----------------------------------------------------------------------
3e96A           ----------------------------------------------------------------------
1a50A           ----------------------------------------------------------------------
2clfA           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
2cg8C           ETLLAIE---------SELGRLIDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAPHFI-----
1a5sA           ----------------------------------------------------------------------
2cg8B           ETLLAIESELGRRL--------IDLDLLFVEDQILYTDDLILPHPYIAERLFVLESLQEIAPHFIHPIL-
2csbA           ----------------------------------------------------------------------
2cw6F           ----------------------------------------------------------------------
2cleA           ----------------------------------------------------------------------
2a0nA           ----------------------------------------------------------------------
2a6lA           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
3bliA           ----------------------------------------------------------------------
3b4uA           ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1beuA           ----------------------------------------------------------------------
1bksA           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
3bpwB           ----------------------------------------------------------------------
2ebfX           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PVSxxxxxxxxxxxx
2bmbA           ---------------
1ad1A           ---------------
1aj0A           ---------------
1ad4A           ---------------
1cbkA           IIT------------
3dz1A           ---------------
2dzaA           ---------------
2dzbB           ---------------
2dzaB           ---------------
1ad4B           ---------------
2dzbA           ---------------
3b8pE           ---------------
3bofA           ---------------
3di0A           ---------------
2e7fA           ---------------
2dqwA           ---------------
3bolA           ---------------
2dqwB           ---------------
3bq6B           ---------------
3eb2D           ---------------
3bq6A           ---------------
3bq5B           ---------------
3di1B           ---------------
1ad1B           ---------------
3bolB           ---------------
3bq5A           ---------------
3c0jA           ---------------
3d0cB           ---------------
2ehhA           ---------------
3bofB           ---------------
3e96B           ---------------
3d0cA           ---------------
2cg8A           ---------------
2ehhC           ---------------
2a6nA           ---------------
2cg8D           ---------------
3daqA           ---------------
3bi8A           ---------------
2clhA           ---------------
3di1A           ---------------
2cliA           ---------------
3denA           ---------------
1a5bA           ---------------
3di0B           ---------------
3e96A           ---------------
1a50A           ---------------
2clfA           ---------------
3eb2A           ---------------
3eb2B           ---------------
2cg8C           ---------------
1a5sA           ---------------
2cg8B           ---------------
2csbA           ---------------
2cw6F           ---------------
2cleA           ---------------
2a0nA           ---------------
2a6lA           ---------------
1b3oB           ---------------
3bliA           ---------------
3b4uA           ---------------
1efzA           ---------------
1beuA           ---------------
1bksA           ---------------
1ak5A           ---------------
3bpwB           ---------------
2ebfX           ---------------