[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56911.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dy0B.bssp"
#ERROR : Can't open dsspfile "2dy0A.bssp"
#ERROR : Can't open dsspfile "1a4xA.bssp"
#ERROR : Can't open dsspfile "1a3cA.bssp"
#ERROR : Can't open dsspfile "3dezB.bssp"
#ERROR : Can't open dsspfile "1dbrC.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "1a97D.bssp"
#ERROR : Can't open dsspfile "2ehjA.bssp"
#ERROR : Can't open dsspfile "1a97B.bssp"
#ERROR : Can't open dsspfile "3efhA.bssp"
#ERROR : Can't open dsspfile "1dqnA.bssp"
#ERROR : Can't open dsspfile "1a96D.bssp"
#ERROR : Can't open dsspfile "1bd3D.bssp"
#ERROR : Can't open dsspfile "1a95B.bssp"
#ERROR : Can't open dsspfile "1d6nA.bssp"
#ERROR : Can't open dsspfile "2aeeA.bssp"
#ERROR : Can't open dsspfile "1a97A.bssp"
#ERROR : Can't open dsspfile "3dmpC.bssp"
#ERROR : Can't open dsspfile "1a95D.bssp"
#ERROR : Can't open dsspfile "2aeeB.bssp"
#ERROR : Can't open dsspfile "1a95A.bssp"
#ERROR : Can't open dsspfile "3dezA.bssp"
#ERROR : Can't open dsspfile "1dbrB.bssp"
#ERROR : Can't open dsspfile "1dbrA.bssp"
#ERROR : Can't open dsspfile "1cjbC.bssp"
#ERROR : Can't open dsspfile "3dahC.bssp"
#ERROR : Can't open dsspfile "1cjbA.bssp"
#ERROR : Can't open dsspfile "1a4xB.bssp"
#ERROR : Can't open dsspfile "3dmpA.bssp"
#ERROR : Can't open dsspfile "2e55A.bssp"

## Summary of PDB Search
:191
    4e-17  22%  2dy0B  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    3e-16  22%  2dy0A  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    3e-11  12%  1a4xA  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    4e-11  12%  1a3cA  [x.x.x] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    1e-10  14%  3dezB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    5e-10  18%  1dbrC  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    9e-10  12%  1bzyA  [c.61.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-09  15%  1a97D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-09  12%  2ehjA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    4e-09  14%  1a97B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    5e-09  13%  3efhA  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE 1
    6e-09  12%  1dqnA  [c.61.1] GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-08  15%  1a96D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-08   9%  1bd3D  [c.61.1] URACIL PHOSPHORIBOSYLTRANSFERASE
    2e-08  16%  1a95B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-08  14%  1d6nA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    3e-08  14%  2aeeA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    3e-08  15%  1a97A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-08  10%  3dmpC  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    6e-08  15%  1a95D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-07  13%  2aeeB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    1e-07  15%  1a95A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-07  14%  3dezA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    2e-07  16%  1dbrB  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    6e-07  18%  1dbrA  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    2e-06  10%  1cjbC  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    3e-06  15%  3dahC  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
    8e-06  10%  1cjbA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    9e-06  13%  1a4xB  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    2e-05   9%  3dmpA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    3e-05  16%  2e55A  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
:191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVAR
2dy0B           LEYLKNSIKSIQDYPKPGILFRD-VTSLLEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVAL
2dy0A           LEYLKNSIKSIQDYPKPGILFRD-VTSLLEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVAL
1a4xA           ------------------------ILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAE
1a3cA           -----------------------------LDEQAIRRALTRIAHEMIERNKCILVGIKTRGIYLAKRLAE
3dezB           ------------------------------YPETRTLIENGFVETIKEAFVEVIAGTATAGIPHGAIIAD
1dbrC           ------------------------LLPGGLVKDRVEKLAYDIHRTYFGEELH-IICILKGSRGFFNLLID
1bzyA           ---------------------ERVFIPHGLIMDRTERLARDVMKEM-GGHHIVALCVLKGGYKFFADLLD
1a97D           --------------------------------MLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLAR
2ehjA           ------GLMREQDIS--TKRFRELASEVGSLLTYEATADLETEKVTIEGWNGPVEIDQIKGKKITVVPIL
1a97B           -----------------------------VTWDMLQIHARKLASRLMSEQWKGIIAVSRGGLVPGALLAR
3efhA           ANMLSVAGADHIITMDLHASQIQGFFDIPVDLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIAD
1dqnA           -DVLSTFFKDRNDVLESEVKKFHLLATFEECKALAADTARRMEYYKDVAEPVTLVALLTGAYLYASLLTV
1a96D           --------------------------------MLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLAR
1bd3D           ------EEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRA
1a95B           --------------------------------MLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLAR
1d6nA           ------------------------FIPHGLIMDRTERLARDVMKEMGGHHIV-ALCVLAGGYKFFADLLD
2aeeA           LDIKAVYLKPEDPFTWASGIKSPIYTDNRSYPKTRDLIENGFVETIKAHFVEVIAGTATAGIPHGAIIAD
1a97A           --------------------------------MLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLAR
3dmpC           ------------------------TRNLPITTKRVETPLVEIDAPVIAGKKLAIVPVLRAGVGMSDGLLE
1a95D           --------------------------------MLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLAR
2aeeB           LDIKAVYLKPEDPFTWASGIKSPIYTDNRSYPKTRDLIENGFVETIKAHFVEVIAGTATAGIPHGAIIAD
1a95A           --------------------------------MLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLAR
3dezA           --------------------------------ETRTLIENGFVETIKEAFVEVIAGTATAGIPHGAIIAD
1dbrB           ----DNTFYNADDFLVPPHCKPYILLPGGLVKDRVEKLAYDIHRTYFGEELH-IICILKGSRGFFNLLID
1dbrA           ------------------------LLPGGLVKDRVEKLAYDIHRTYFGEELH-IICILKGSRGFFNLLID
1cjbC           ------------------------LVPNGVIKNRIEKLAYDIKKVYNNEEFH-ILCLLKGSRGFFTALLK
3dahC           ----------------------------------------------------------------------
1cjbA           ------------------------LVPNGVIKNRIEKLAYDIKKVYNNEEFH-ILCLLKGSRGFFTALLK
1a4xB           ------------------------ILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAE
3dmpA           -----------------THMRDKDTSTRT-FRELLREITLLMGYEITRNLPITTKRVETIAGKKLAIVPV
2e55A           -----------------------------------------------------FVPILRAGLSFLEGALQ


                         .         .         *         .         .         .         .:140
query           HFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIELV
2dy0B           GLGVGFVPVRKPGKLP----RETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
2dy0A           GLGVGFVPVRKPGKL----PRETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLI
1a4xA           RIEQIEGNPVTVGEIDITLYREPLVKG-----------ADIPVDITDQKVILVDDVLYTGRTVRAGMDAL
1a3cA           RIEQIEGNPVTVGEIDITLYRNDEPLVKGAD---------IPVDITDQKVILVDDVLYTGRTVRAGMDAL
3dezB           KMNLPLAYIRSQI---------------------------EGRVTKGQKMVIIEDLISTGGSVLDAVAAA
1dbrC           YLATIQKYSGRESSVPPFFEHYVRLLTVLSDDL---------SIFRDKHVLIVEDIVDTGFTLTEFGERL
1bzyA           YIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLV
1a97D           ELGIRHVD---------------TVAISSYLKVLKRAEGD------GEGFIVIDDLVDTGGTAVAIREMY
2ehjA           RAGLGMMDGV-LENVPSARISVVGMYRNEETLEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLL
1a97B           ELGIRHVDTVAISSYDHDNQRELK--------------VLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
3efhA           RLNVDFALIHKERKMVLVGDVK------------------------DRVAILVDDMADTCGTICHAADKL
1dqnA           HLTFPYTLHFVKVSSYKGTRQESVVFDEE----------DLKQLKEKREVVLIDEYVDSGHTIFSIQEQI
1a96D           ELGIRHVDTVCISS----YRELKVLKRAEGDGE---------------GFIVIDDLVDTGGTAVAIREMY
1bd3D           VCRGVRIGKILIQ----RDETTAEPKLIYEK---------LPADIRERWVMLLDPMCATAGSVCKAIEVL
1a95B           ELGIRHVDT---------------VCISSYDHDNQRELKVLKAEGDGEGFIVIDDLVDTGGTAVAIREMY
1d6nA           YIKALNRNSDRSIPMTVDFIRLGSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLV
2aeeA           KMTLPFAYIRSKPKGNQIEGRV----------------------LKGQKMVIIEDLISTGGSVLDAAAAA
1a97A           ELGIRHVDTVAISSYDRELKV------------------LKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
3dmpC           LIPSARVGHIGVYRADDRPVEYLV----------------RLPDLEDRIFILCDPMVATGYSAAHAIDVL
1a95D           ELGIRHVDTVCISSYR----ELKVLKRAEGDGE---------------GFIVIDDLVDTGGTAVAIREMY
2aeeB           KMTLPFAYIRSKPNQIEGRVL------------------------KGQKMVIIEDLISTGGSVLDAAAAA
1a95A           ELGIRHVDT---------------VCISSYNQRELKVLK--RAEGDGEGFIVIDDLVDTGGTAVAIREMY
3dezA           KMNLPLAYIRSKPKNQIEGRVT-----------------------KGQKMVIIEDLISTGGSVLDAVAAA
1dbrB           YLATIQKYSGRESSVPPFFEHYVRLLTVLSD---------DLSIFRDKHVLIVEDIVDTGFTLTEFGERL
1dbrA           YLATIQKYSGRESSVPPFFEHYVRLQNDNSTGQLT-VLSDDLSIFRDKHVLIVEDIVDTGFTLTEFGERL
1cjbC           HLSRIYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYL
3dahC           ----------------------------------------------GRTCVIMDDMVDTAGTLCKAAQVL
1cjbA           HLSRIYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYL
1a4xB           RIEQIEGNPVTVGEIDITLYDEPLVKGADI-----------PVDITDQKVILVDDVLYTGRTVRAGMDAL
3dmpA           LRAGVGMSDGLLELIPSARV-GHIGVYRADDHRPV-EYLVRLPDLEDRIFILCDPMVATGYSAAHAIDVL
2e55A           VVPNAKVGFLGIKRNEETLESH--------------IYYSRLPELKGKIVVILDPMLATGGTLEVALREI


                         +         .         .         .         .         *         .:210
query           GEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERMDPETGEIxxx
2dy0B           RRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLV---------------
2dy0A           RRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLV---------------
1a4xA           VDVGRPSSIQLAVLVD-RGHRELPIRADYIGKNIP----------------
1a3cA           VDVGRPSSIQLAVLVD-RGHRELPIRADYIGKNIPSKSEKVMVQLDEV---
3dezB           QREGADVLGVVAIFTYELPKATANFEKASVKLVTLSNYSEL----------
1dbrC           KAVGPKSMRIATLVEK-----------------------------------
1bzyA           RQYNPKMVKVASLLVKRTPRS------------------------------
1a97D           PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVF----------
2ehjA           KKAGCSSIKVLVLVAAP--EGIAALEKAHPDVELY----------------
1a97B           PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVF----------
3efhA           LSAGATRVYAILTHGIFSGPAISRINNACFEAVVV----------------
1dqnA           KHAKICSCFVKDVDAI-----------------------------------
1a96D           PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVF----------
1bd3D           LRLGVKEERIIFVNILAAPQGIERVFKEY----------------------
1a95B           PKAHFVTIFAKPAGRPLVDDYVVDI--------------------------
1d6nA           RQYNPKMVKVASLLVKRTPRS------------------------------
2aeeA           SREGADVLGVVAIFTYELPKASQNFKEAGIKLITLSN--------------
1a97A           PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVF----------
3dmpC           KRRGVPGERLMFLALVAAPEGVQVFQDAHPDVKLYV---------------
1a95D           PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGV------------
2aeeB           SREGADVLGVVAIFTYELPKASQNFKEAGIKLITL----------------
1a95A           PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVF----------
3dezA           QREGADVLGVVAIFTYELPKATANFEKASVKLVTLSNYSELIKV-------
1dbrB           KAVGPKSMRIATLVEK-----------------------------------
1dbrA           KAVGPKSMRIATLVE------------------------------------
1cjbC           KKFEIKTVAIACLFIKRTPLWNGFKADF-----------------------
3dahC           KERGAKQVFAYATHPVLSGGAADRIAASALD--------------------
1cjbA           KKFEIKTVAIACLFIKRTPLWNGFKADF-----------------------
1a4xB           VDVGRPSSIQLAVLVD-----------------------------------
3dmpA           KRRGVPGERLMFLALVAAPEGVQVFQDAH--PDVKLYVASLDSHLDDH---
2e55A           LKHSPLKVKSVHAIAAP--EGLKRIEEKFK---------------------