[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for elen0:ACV56973.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bc6A.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1bqxA.bssp"
#ERROR : Can't open dsspfile "1b0tA.bssp"
#ERROR : Can't open dsspfile "1d3wA.bssp"
#ERROR : Can't open dsspfile "1b0vA.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "1d0cB.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1clfA.bssp"
#ERROR : Can't open dsspfile "1dwlA.bssp"

## Summary of PDB Search
:219
    1e-12  25%  1bc6A  [x.x.x] 7-FE FERREDOXIN
    7e-11  17%  1a6lA  [x.x.x] FERREDOXIN
    3e-10  24%  1bqxA  [d.58.1] PROTEIN (FERREDOXIN)
    3e-09  18%  1b0tA  [d.58.1] PROTEIN (FERREDOXIN I)
    2e-08  19%  1d3wA  [d.58.1] FERREDOXIN 1
    1e-07  15%  1b0vA  [d.58.1] PROTEIN (FERREDOXIN)
    2e-06  32%  1durA  [d.58.1] 2[4FE-4S] FERREDOXIN
    5e-06   8%  1d0cB  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    6e-06   5%  1d0cA  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    1e-05  25%  1bluA  [x.x.x] FERREDOXIN
    3e-05  26%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-05  35%  1clfA  [x.x.x] FERREDOXIN
    1e-04  29%  1dwlA  [i.4.1] FERREDOXIN I
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN
1bc6A           ----------------------------------------------------------YVITEPCIGTKD
1a6lA           ----------------------------------------------------------FVVTDNCIKCKY
1bqxA           ----------------------------------------------------------YVITEPCIGTKC
1b0tA           ----------------------------------------------------------FVVTDNCIKCKY
1d3wA           ----------------------------------------------------------FVVTDNCIKCKY
1b0vA           ----------------------------------------------------------FVVTDNCIKCKY
1durA           ----------------------------------------------------------YVINDSCIACGA
1d0cB           -----ITYDTLCAQSQQDGPCTPRRCLGSLVL-----PRKLQTRPSPGPPPAEQLLSQARDFINQYYSSI
1d0cA           -------TLCAQSQQDGPCTPRRCLGSLSQARDFINQYYSSIKGSQAHEERLQEVEAEVASTGTYHLRES
1bluA           ----------------------------------------------------------------------
3bk7A           ---------------------------------------------------------------NPDKCGH
1clfA           ----------------------------------------------------------YKIADSCVSCGA
1dwlA           ----------------------------------------------------------------CIGCE-


                         .         .         *         .         .         .         .:140
query           PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCV
1bc6A           ASCVEVCPVDCIHE-GEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK-----
1a6lA           CDCVEVCPVDC-FYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNIT
1bqxA           ASCVEVCPVDC-IHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK-----
1b0tA           TKCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPEDK
1d3wA           TECVEVCPVDC-FYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQFIQLNAELAEVWPNITE
1b0vA           TDCVEVCPVDC-FYEGPNFLVIHPDECNDCALCEPECPAQAIFSEEVPEDMQEFIQLNAELAEVWPNITE
1durA           --CKPECPVNC--IQEGSIYAIDADSCIDCGSCASVCPVGAPNPE-------------------------
1d0cB           KRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQA-------------------------------
1d0cA           ELVFGAKQAWRDARDCSSAQEMFTYICNHIKYA--TNRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAG
1bluA           ---------------------MITDECINCDVCEPECPNGAISQG-DETYVIEPSLCTECVGHYETSQCV
3bk7A           FLCERVCPVNRMGGEENYKPIIQEASCTGCGICVHKCPF-------------------------------
1clfA           --CASECPVNAISQGD-SIFVIDADTCIDCGNCANVCPVGAPV---------------------------
1dwlA           -SCVELCPEVFAMIDGEEMVTAPDSTAECAQDAIDACPVEAISK--------------------------


                         +         .         .         .         .         *         .:210
query           AQCGARARFFGDLDQGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bc6A           ----------------------------------------------------------------------
1a6lA           EKKDPLPDAED-----------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1b0tA           DPLPDAEDWDGVKG--------------------------------------------------------
1d3wA           KKDPLPDAEDWDGVKG------------------------------------------------------
1b0vA           KKD-------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------
1d0cA           YRQ-------------------------------------------------------------------
1bluA           EVCPVDCIIKDPSHE-------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------
1dwlA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxx
1bc6A           ---------
1a6lA           ---------
1bqxA           ---------
1b0tA           ---------
1d3wA           ---------
1b0vA           ---------
1durA           ---------
1d0cB           ---------
1d0cA           ---------
1bluA           ---------
3bk7A           ---------
1clfA           ---------
1dwlA           ---------