[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV54068.1

[Show Plain Result]


## Summary of Sequence Search
    1::158
    1::83      2e-14  43%   83 aa  PF02082 Rrf2 "Transcriptional regulator"
    1::158

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPA
PF02082         MKLSSKTDYALRALLYLALHGGPVTSAEIAERLGISPSYLRKILAKLRKAGLVESVRGKGGGYRLARPPE


                         .         .         *         .         .         .         .:140
query           DTNVLEIMEALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02082         EITLGDVVRAL-----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxx
PF02082         ------------------