[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV54358.1

[Show Plain Result]


## Summary of Sequence Search
    1::589
    1::362     8e-15  35%  375 aa  PF00890 FAD_binding_2 "FAD binding domain"
    2::28      2e-04  56%  394 aa  PF03486 HI0933_like "HI0933-like protein"
    1::589

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00890         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxDIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKFHERLG
PF00890         -----------------DVLVVGGGLAGLSAALEAAEAGAKVLLLTGGHTAAAQGGINAALGNQAGIGDS
PF03486         -----------------DVIVIGAGAAGLMAAITAAEAGARVLL--------------------------


                         +         .         .         .         .         *         .:210
query           ITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAH
PF00890         PEDHFYDTLDGLADEDLVE-----------ALVEEAPEAVDWLEEL----------GVPFSRTDGIDLRR
PF03486         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PGSHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNY
PF00890         FGGHSARRTAHAAD---RTGKALLATLYEAALK-AGVEIFEETFALDLITDD---GRVTGVVAENLRTGE
PF03486         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VKYVGRKAIVLATGDFSANQDMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTL
PF00890         VVRIRAKAVVLATGGFGRPPEVYGRTTNPPG-------------------NTGDGIAMALRAGAAFVQFH
PF03486         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PNAPMIDAVGPMPYRQSIADFSGLLLNKKGERYSNExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00890         PTG-LPDGAGIL-ITEALRGEGGILVNKDGERFMNE----------------------------------
PF03486         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEVIAQLDGLDPENAKKSVERYNELCEAKY
PF00890         ----------------------------------------DHVYLDLDHLDAEGLEATLPRYNELAAAGA
PF03486         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQNEPIEGLYNLGIMVGxxxxx
PF00890         DVD---------PTKE------PIPVVPAAHYTM-GGLRTDEDGRV-DADGKPIPGLYAAGEVAG-----
PF03486         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00890         -----------------------------
PF03486         -----------------------------