[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV54398.1

[Show Plain Result]


## Summary of Sequence Search
    1::447
  166::391     1e-08  27%  405 aa  PF00501 AMP-binding "AMP-binding enzyme"
   12::327     2e-07  33%  345 aa  PF04443 LuxE "Acyl-protein synthetase, LuxE"
    1::447

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFP
PF00501         ----------------------------------------------------------------------
PF04443         ------------------------EELFLALALELFRYQYENNPVYRKFCDALGVDPEDVEDLADIPFLP


                         .         .         *         .         .         .         .:140
query           FCDKKTERETQHVGSFFGEMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPN
PF00501         -----------------------------------------------------------------GLTPG
PF04443         I-------------SFFHKLLSVPEEEI--------------EAVFTSSGTTGQKSRIAR-----DRLTI


                         +         .         .         .         .         *         .:210
query           DRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGF
PF00501         DRVLSVLPLHHDGGVGGLLGPLLAGATLVLLPGFDPERLLELIEKYRVTVLFAVPTLLRALLKAPEER--
PF04443         ERQLGSVNRIMYFGGPDVLGPSRFNAMVLVELLFPSEGLLAALKEAEPVLLIGFTFFIYLLLDYLKERGI


                         .         .         .         +         .         .         .:280
query           DPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDGLHIVEDQILVET
PF00501         --KYDLSSLRLVLSGGEPLPPELLERFRERFGGIPLVNGYGLTETGGVVTVNPDKPGSVGRPLPGVEVRI
PF04443         ----SFNLPKGSRVIDGGGWKGRRKEAVDR------EEFYALAEVFGVPRENIRDEYGMTELNSQFYVII


                         .         *         .         .         .         .         +:350
query           VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRTLARIHVTGRKDEMFIVGAVN
PF00501         VDPD-GRPVPPGEVGELVV-----RGPGVMRYRTGDLGRLDED--------GYLFILGRKKDLIKVGGEN
PF04443         RDPETLEPLPDGETGLLNVIDLANTSSPGF-ILTEDLGVVHED--ECGRPGKTFEILGR-----------


                         .         .         .         .         *         .         .:420
query           VFPSDIExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00501         VEPAEIE---------------------------------------------------------------
PF04443         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00501         ---------------------------
PF04443         ---------------------------