[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV54452.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
    3::235     3e-15  33%  272 aa  PF04976 DmsC "DMSO reductase anchor subunit (DmsC)"
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxEITLVLFTTLAPSGVVAFICMGLPVLGRGASVALRQRLNVFLGLPLVVAMVGLVASATHL
PF04976         ----------EWPLVFFTVLSQAAVGAFIVLALALLAGKLGAAARQRVLRAMLLALVLMGLGLLASTLHL


                         .         .         *         .         .         .         .:140
query           GNPANALYVFLGVGRSPLSTEVFCAVVFLALAGLYWLYNFVEHPKPQLQRAWXXXXXXXXXXXXXXXXXX
PF04976         GRPLRAFNALNRVGTSWLSREILAGSLFFAVAGLYWLLAVLGKLPPALGKLLLLLAALLGLAFVFCMAMI


                         +         .         .         .         .         *         .:210
query           XXXDTIVSWHTVYVPLNLMLNALVGGPILAIAGLRAAGYEPVEGRMGRXXXXXXXXXXXXXXXXFGVQGA
PF04976         YAITTVPTWNSPLTPLNFFLTALLLGALLAALLLALAG---VPGGALLALAALSVLALVIAAVVTVLQGA


                         .         .         .         +         .         .         .:280
query           DLASIENSYLTAAELVPSYGLMVCAFGVLGMAGIGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04976         SLRAIHSSVQQASALVPDYGKLRAWRLVLLAAGPGL----------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
PF04976         ------------