[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV54634.1

[Show Plain Result]


## Summary of Sequence Search
    1::367
   23::353     5e-79  47%  354 aa  PF06032 DUF917 "Protein of unknown function (DUF917)"
    1::367

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxDPYIGKLTAIGAVKECGEVELIGIDEVPDGAFIMPAASMGAPTIL
PF06032         -------------------------DPYIGYLLARQALREGGPVRLVSPDELPDDALVVPVAMMGAPAVS


                         .         .         *         .         .         .         .:140
query           AEKGVGANEFAKLFDMVSRYYGKPIYATMPIEAGGVNSMLPIAAAARLGIPMVDVDGMGRAFPELQMVTF
PF06032         IEKLPSGDEALRAVEALEKYLGRKIDAVIPLEIGGSNGLVPLLAAAKLGLPVVDADGMGRAFPTLQMTTF


                         +         .         .         .         .         *         .:210
query           TIGGASATPMAFIDEKGNSGILDTITNKWTEDIARAATMTMGGTLTVALFCMDVDTCKQYGVHGIVTRSE
PF06032         AVAGIPITPAALADEGGNVVIVKAADNAWAERIARAACVEMGGSAGVARYPMTGAELKRAAVPGTLSLAL


                         .         .         .         +         .         .         .:280
query           ELGRAIRTAKDEAAAAGLTPEEFFLKFTGGHKLFKGKISDVLRETRGAFNFGRVVLEGIGEDRGSQAFVD
PF06032         EIGRAVRAAR----ANGRDVIDAILDALGGKVLFTGKIVDVERRTRGGFDVGKVVIEGLDEDGGRTLTIP


                         .         *         .         .         .         .         +:350
query           FQNENLSCVVDGQIKATVPDLICLVDPDTFTPVPTDALKYGKRVLAVGLECFHLWRTQAGLDLVGPRYFG
PF06032         FQNENLLAWRDGEVLATVPDLICVLDAETGEPITTEELRYGLRVAVIALPAPPLWRTPEGLEVGGPRAFG


                         .         .         .         .         *         .         .:420
query           IDTDYIPVxxxxxxxxx
PF06032         YDIDYVPL---------