[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV54955.1

[Show Plain Result]


## Summary of Sequence Search
    1::381
    1::237     2e-66  52%  238 aa  PF01702 TGT "Queuine tRNA-ribosyltransferase"
    1::381

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01702         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxESNMEIQEQLGAD
PF01702         ---------------------------------------------------------QKSMEIQNALGSD


                         +         .         .         .         .         *         .:210
query           IAMQLDQCTPYPAEKAFVAKAVDLSANWARRCLAAHQRPDQTLFGIVQGGMXXXXXXXXXXXXXXXXXXX
PF01702         IIMALDECTPYPATKDRAEKSMERTLRWAQRCLKAHQRNKQALFGIVQGGSYEDLRRESAKDLVEMGFDG


                         .         .         .         +         .         .         .:280
query           XAXXXXXXXXXXXXXYSVGEDHEVMFETLGPVARACPEDRPRYLMGVGNPTTLVRAVREGVDMFDCVLPT
PF01702         YAIGGL----------SVGEPKEEMLEILEATAPLLPEDKPRYLMGVGTPEDILEAVALGVDMFDCVLPT


                         .         *         .         .         .         .         +:350
query           RTARMGTAFSSTGRMNMRNAKFTRDFGPLDPACTCPTCRNHSRAYIRHLVKQNEMLGGILLSVHNLHYLI
PF01702         RNARNGTALTFDGRINLKNAKYKDDFRPLDPGCDCYTCRNYSRAYLHHLLKAKEMLGARLLTIHNLHYYL


                         .         .         .         .         *         .         .:420
query           DLMRRAREAVLAGAYEEFYEAWMxxxxxxxx
PF01702         RLMAEIRQAIEEGRFDEFVEEFI--------