[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV54981.1

[Show Plain Result]


## Summary of Sequence Search
    1::235
    1::110     5e-20  43%  111 aa  PF00072 Response_reg "Response regulator receiver domain"
    1::76      4e-15  42%   77 aa  PF00486 Trans_reg_C "Transcriptional regulatory protein, C
    1::235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDGFTTCRLMRER
PF00072         ---ILIVDDDPVNRELLKRLLEKLGYVVTTAEDGEEALELLEEHRPDLVLLDINMPGMDGLELLRRIREL
PF00486         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00072         EPDIPIIVLTAYDDEEDAVRALEAGADDYLTKPFDPEELLAAI---------------------------
PF00486         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxGERLSLTPKEFKIFFALASSPGLVLSKEQLVEAAWGKEFVGETSSITVFIKKLREKVED
PF00072         ----------------------------------------------------------------------
PF00486         -----------GGEVELTPKEFRLLALLLLNPGRVVSREELLEEVWGDDPAVDDNTLDVHISRLRRKLED


                         .         .         .         +         .         .         .:280
query           DPSDPRVIQTVWGIGYRxxxxxxxx
PF00072         -------------------------
PF00486         AGGAPKLIETVRGVGYR--------