[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55062.1

[Show Plain Result]


## Summary of Sequence Search
    1::359
   15::150     5e-12  30%  156 aa  PF00174 Oxidored_molyb "Oxidoreductase molybdopterin binding
   24::98      2e-04  30%  120 aa  PF03404 Mo-co_dimer "Mo-co oxidoreductase dimerisation domain"
    1::359

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00174         ----------------------------------------------------------------------
PF03404         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVNVGGNIKKNFTIDVRDLAEDAN
PF00174         -----------------------------------------------LTVDGLVERPLTLSLDDLRALPQ
PF03404         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QETMMACSCATGSPFGQAAVMGVPLSAVVEMADLEDGVNTITAYGADGFGQPLPLRYALEKNALLAYQVN
PF00174         VEVTTRLQCVGNQSAGNATWTGVPLRDLLKKAGVKPGAKYVVFEGADGYGASIPLEDALDPDVILAYEMN
PF03404         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GQELEAATGSSLQLWMPETVARYFTRDIVNIELTQEDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxGDEI
PF00174         GEPLPPDHGYPLRLVVPGKYGAKSVKWLVRIEVTDEES--------------------------------
PF03404         ------------------------------------------------------------------GGPY


                         .         *         .         .         .         .         +:350
query           TFEGVADDLGSPIAAIEFSFDNGRTWTSCDTDGATADKWVNWQFTTSFEEKGDYRMTVRAKTADGMVSPx
PF00174         ----------------------------------------------------------------------
PF03404         TVRGYAWSGGGGITRVEVSLDGGKTWRLAELDGPESPYWCFWSLDWDVPDLGAKEIAVRATDEAGNTQP-


                         .         .         .         .         *         .         .:420
query           xxxxxxxxx
PF00174         ---------
PF03404         ---------