[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55075.1

[Show Plain Result]


## Summary of Sequence Search
    1::286
   16::215     3e-30  46%  215 aa  PF00889 EF_TS "Elongation factor TS"
    1::286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00889         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxAVVELNCETDFVGMNDKFKAYAEKIAQAALASKPXXXXXXXXXXXXGETVEAVVTDAIHTLGENIQL
PF00889         ---AIVELNCETDFVAKNEDFQALVKDVADTAAAAKPADVEELLALPMSGKTVEEAITDLIAKIGEKISL


                         +         .         .         .         .         *         .:210
query           ARFAVVEGGAVSSYIHGGGKIGVLVQFDVEGIDPASDGFKQFGRDXXXXXXXXXXXXXTRESVDPAIVEH
PF00889         RRFAKVEAGVVGSYVHGGGRIGVLVA--LEGADD-----DELAKDVAMHIAAMNPQYLSREDVPAEVVEK


                         .         .         .         +         .         .         .:280
query           EKAIYMAQAAESGKPEAIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAAEVAKNLGGEIKIVDFK
PF00889         EREIAKEQAKAEGKPEKIIEKIVEGRLKKFLKEVCLLEQPFVKDPKKTVAQYLKEAG------AKVVGFV


                         .         *         .         .         .         .         +:350
query           RFVLGx
PF00889         RFEVG-