[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55249.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    3::125     2e-07  34%  128 aa  PF01750 HycI "Hydrogenase maturation protease"
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYDVIITVDAVDG
PF01750         -------------------------VVERLEERYLPPENVEVIDGGTAGLNLLDALEGADRLIIVDAVD-


                         .         .         *         .         .         .         .:140
query           TDADPGTVFRFEPDAMARHSGATASLHDLKLVDLFDXXXXXXXXXXXXXXXMQVENPSPAVVTVGLTPKV
PF01750         SGLEPGTVRRLDPDELPALGAKKMSTHQLGLAEVL--ALLRLLGGLPKEVVLVGIEPASLEDGLGLSPEV


                         +         .         .         .         .         *         .:210
query           DAALPLLVETVxxxxxxxxxxxxxxx
PF01750         AAAVPEAVELV---------------