[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55454.1

[Show Plain Result]


## Summary of Sequence Search
    1::1228
   14::264     6e-18  26%  274 aa  PF00664 ABC_membrane "ABC transporter transmembrane region"
    1::123     3e-12  43%  123 aa  PF00005 ABC_tran "ABC transporter"
  455::526     7e-05  37%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"
   86::218     3e-08  23%  274 aa  PF00664 ABC_membrane "ABC transporter transmembrane region"(query 116->250)
    1::1228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRIPLGHIARLGTGRISKVMDESVGG
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ---------------------------------------------RLPLSFFDRNPTGELLSRLTNDVEA


                         +         .         .         .         .         *         .:210
query           IEQFIGHSIPDXXXXXXXXXXXXXXXFVFDWRFGXXXXXXXXXXXXXQFSGYADKRVMASMGRYQEVKEQ
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         IDDLLGSTLPLLLQALLTLVGALILLFLLSWKLALVLLAVLPLLIL--LAALFGKRLRKLSRKEQEARSE


                         .         .         .         +         .         .         .:280
query           MGNASVEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         LNSVLEESLSGIRTVKAFGAEERELERFEEALDEYRKASL------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLALMIPFVCTVAAFAALVGTLAGEPFDAAALWSIF
PF00664         -----------------------------------LALLLPLL-----LGRLIDSLSGDELSTLYLLALL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AVGLAGMVVVFVASRNDYKKTYVAAYTESEGTRLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESM
PF00664         LLALAVLIALLL-----YLSFYLAARLGQRDLRRRLFRKLLRLPLSFFDRNPTGELLSRLTNDVEAIDDL
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALSRRHQSRLFERQNRVRLDALACVQ
PF00664         LGSTLPLLLQALLTLVGALILLFLLSWKLALVLLAVLPLLILLAALFGKRLRKLSRKEQEARSELNSVLE
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           DYLEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGG
PF00664         ESLSGIRTVKAFGAEERELERFEEALDEYRKASLKAARLSALLSPLLQLLGALSLALVLWLGGYLVLSGE
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VDFMVLLMFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         LTVGDLVAFL------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIV
PF00664         ----------------------------------------------------------------------
PF00005         ------------------------------STLLRLLAGLLKPTSGKILLDGV-ISPLELRKL--RIGYV
PF02463         ----------------------------------------------------------------------
PF00664         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           FQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIAR
PF00664         ----------------------------------------------------------------------
PF00005         FQDPALFPHTVRENIAFGKKKEAKEEILEALERVGLLKFLYRYPH-----------ELSGGQRQRVAIAR
PF02463         ---------------------------------------------------------LSGGEKSLTALAL
PF00664         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           ALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRLRTVANADKIxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF00005         ALIKEPKVLLLDEPTS------------------------------------------------------
PF02463         LFYKPAPFYVLDEVDAALDDANVQRVADLLKELSKNSQFIVITHRPGTMELADRL---------------
PF00664         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         --------------------------------------
PF00005         --------------------------------------
PF02463         --------------------------------------
PF00664         --------------------------------------