[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55525.1

[Show Plain Result]


## Summary of Sequence Search
    1::948
    5::592     e-155  49%  593 aa  PF00133 tRNA-synt_1 "tRNA synthetases class I (I, L, M and V)"
    1::145     8e-23  37%  153 aa  PF08264 Anticodon_1 "Anticodon-binding domain"
    8::326     4e-14  37%  363 aa  PF09334 tRNA-synt_1g "tRNA synthetases class I (M)"
  222::299     8e-09  39%  300 aa  PF01406 tRNA-synt_1e "tRNA synthetases class I (C) catalytic
  121::255     2e-04  26%  772 aa  PF10139 Virul_Fac "Putative bacterial virulence factor"
  239::334     3e-04  26%  354 aa  PF01921 tRNA-synt_1f "tRNA synthetases class I (K)"
    1::948

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKWEEEHIYEQVLEKNKDGKPFILHDGPPYANGPIHIGHA
PF00133         -------------------------------RWEENGIFEASARK---GKPFVIHDGPPYANGSLHIGHA
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------PYANGKPHLGHA
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTLGPDKMAKIDQPTLRRLCREWAEKYVDVQR
PF00133         LNYTIKDIIARYKRMQGYNVLYPPGWDCHGLPIELKVEKKLGI-KGGDLGREEFREKCREWAEEYIGEIR
PF08264         ----------------------------------------------------------------------
PF09334         YTYIAADVLARYQRLRGYDVLFLTGTDEHGTPIELKAEKEITP---------------QELVDKYHAEFK
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIEYSDETSP
PF00133         EQLKRLGLSVDWDREYFTMDPNYEAAVQWVFVKLYEKGLIYRGKRPVNWCPVCGTALADAEVEYKEVKSP
PF08264         ----------------------------------------------------------------------
PF09334         ELFKKFGISFD--NFIRTTSPEHKELVQEIFLRLYENGDIYKGEYEQWYCPSDETFLPDRQVE-------
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SIFVKFKMDIMPGMFETAGAAGDAYVLIWTTTPWTLPANTAVSLAPDADYVMVQADGSNMIMARELVEQV
PF00133         SVYVKFPL-----------ADGDVYLVVWTTRPETLPGNTAVAVHPDIEYVL-EKDGEKLILAEALVEKL
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AEIAGWESYDLVRGEDGEPVALKGREFTGLTYTCPVRQDLKGTIIYGDHVTLDSGTGAVHTAPGHGQDDY
PF00133         AK-------KLLELADE-----KGKDLVGKTYIHPLT-GREIPVIAADYVTMDFGTGAVHIAPAHDEDDY
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LVALEFDVPLLMPVDDNGVLTDEAGPFAGLDVDEANPVIIEWLRERGTLVAQKEILHSYPHCWRCHEPVI
PF00133         EVGKRHGLPIINVVDEDGRFTEEAGEFAGLDVFEARKAIVEDLKEKGLLLKIEKYEHSYPHCWRSKTPII
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FRATDQWFVSMDKNSLRENALKAIENDVEWIPAWASNRIGSMVADRPDWCISRQRSWGVPIPVFKCAKCG
PF00133         PRLTDQWFVKVDK--LKERALEAVE-EVNWVPESGEKRFENWLENLRDWCISRQRYWGTPIPVWYCEDGG
PF08264         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           STVANEQTFDAVIDLFYREGADAWFTREPSEYLPRGVKCETCGCTELTPEKDILDVWWESGVSHTSVLKH
PF00133         EVLVGEELVAARVE---EEGADAWLHRPAIDLLPK-------GGGELRRDTDVLDTWFDSGSWPFATLGE
PF08264         ----------------------------------------------------------------------
PF09334         -------------------------------------------------------VWFDALIGYISALGY
PF01406         ----------------------------------------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           REAEGLRFPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDGEGRKMSKSLGNGVDPAEV
PF00133         REEFEYFYPADLYVEGSDQIRGWFASSLMLSTALFGKAPFKNVLTHGLVLDEDGRKMSKSLGNVVDPLDV
PF08264         ----------------------------------------------------------------------
PF09334         LDGEDFKFWADLYFIGKDIVR--FHTIYWPAMMALGLPPKKVFAHGFLTV--EGGKMSKSRGNVVDPDDL
PF01406         ------------------------ENEIAQSEAATGKPFANYWMHNGFTIDGE--KMSKSLGNFITIRDL
PF10139         ----------------------------------------------------------------------
PF01921         ---------------GKDHSSGSYDVSKEIAEILGGEPPEGFVYE--LFLDKGGQKMSSSKGNGITPDEW


                         .         +         .         .         .         .         *:700
query           MAKSGADVLRLWVASVDYSQDVSISDEILQRTSEAYRRIRNTFxxxxxxxxxxxxxxxxxxxxxxxxxxD
PF00133         IDKYGADALRLWLASSDPGRDIGL----------------------------------------------
PF08264         ---------------------------------------------------------------------D
PF09334         LDRYGADALRYYL---------------------------------------------------------
PF01406         LKKYDPEVLRLFLLSTHYRSPLNFSEEALEEAA-------------------------------------
PF10139         ----------------------------------------------------------------------
PF01921         LEYAPPESLRFLMARYKPKKAKRLYFDVIPRLVDEYDRLERKY---------------------------


                         .         .         .         .         +         .         .:770
query           QWAMVRTKHLLDDVSAAYDAYKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPRRRAVQTVLMNI
PF00133         ----------------------------------------------------------------------
PF08264         RWILSRLNETIKKVTEAYENYRFNTALRAIMEFFWNDLCNWYIDETKPWLLAKDEDS-KRRSAQTVLYEV
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF10139         ------------------------------------DIAKILANAFFNDFDQEKPDSPLDEEQITAHLEQ
PF01921         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LEVLVRVLAPVLSFTTDEVWEHYPQAMRERAGRPTNVQLAGWPKASDFAPAIPADGERVSEDFGVIMGVR
PF00133         ----------------------------------------------------------------------
PF08264         LEALLRLLAPFLPFTAEEIW----QQLEELLGKEESVHLAPWPE----------DPEELDEELEAEVELL
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF10139         LQGL-RQPQPVPGLTEDDVVDLWDYLERHFGKAQKELEDHYWPEAAELAPYLSIDDR--AELFSLLWGEN
PF01921         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           EVVTKALEDARGQKVVNKSQEAAVVVTAPRAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00133         ----------------------------------------------------------------------
PF08264         KDVVQAIRKLRAEKNIPPS---------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF10139         PELTQYLHLAHALQALGHAEEVYAPLSAPRA---------------------------------------
PF01921         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00133         --------------------------------------
PF08264         --------------------------------------
PF09334         --------------------------------------
PF01406         --------------------------------------
PF10139         --------------------------------------
PF01921         --------------------------------------