[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55587.1

[Show Plain Result]


## Summary of Sequence Search
    1::352
    1::273     6e-94  63%  274 aa  PF00154 RecA "recA bacterial DNA recombination protein"
   10::115     1e-09  42%  210 aa  PF08423 Rad51 "Rad51"
   26::83      2e-04  34%  145 aa  PF01695 IstB "IstB-like ATP binding protein"
    1::76      3e-04  38%  202 aa  PF06745 KaiC "KaiC"
    1::352

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESS
PF00154         --------------------GKGSIMRLGDNDV-MDIETISTGSLGLDIALGVGGLPRGRIVEIYGPESS
PF08423         ---------------------------------------ISTGSKALDKLLG-GGIETGSITEIFGESGS
PF01695         ---------------------------------------------------------RGENLLLYGPPGT
PF06745         ---------------------------------------LSTGIEELDRVLGGGLVP-GSVVLIGGDPGI


                         .         .         *         .         .         .         .:140
query           GKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXX
PF00154         GKTTLALHAIAEAQKKGGTCAFIDAEHALDPVYARKLGVDIDELLISQPDTGEQALEIADALVRSGAVDV
PF08423         GKTQLCLQLAVNVQELGGLVVYIDTEGTFRPQIAERFGLDPEEVLYARAYNSEHQLELLEQL--------
PF01695         GKTHLAIAIANELLRKGKSVLFVTVPDLLEELKAAKSDGSLEELL-------------------------
PF06745         GKSTLLLQFAANGARRGEKVLYVSGEESAQQIRAERLGLDLEEL--------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMFGNPETTT
PF00154         IVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGNIKKSNTLVIFINQIRMKIGVMFGNPETTT
PF08423         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVE
PF00154         GGNALKFYASVRLDIRRIGQIKDGDEVVGNETRVKVVKNKVAPPFKQAEFDILYGEGISREGELIDLGVE
PF08423         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AGVAKKSGAWYTYGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00154         LGIVKKSGAWYSYG--------------------------------------------------------
PF08423         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xx
PF00154         --
PF08423         --
PF01695         --
PF06745         --