[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55743.1

[Show Plain Result]


## Summary of Sequence Search
    1::394
    1::383     e-126  60%  383 aa  PF00162 PGK "Phosphoglycerate kinase"
    1::394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTIDELDARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMSHLGRPAGEGFE
PF00162         -----SIDDLDLKGKRVLVRVDFNVPLKDGKITDDTRIRAALPTIKYLLEQGAKVILMSHLGRPKGE-YK


                         .         .         *         .         .         .         .:140
query           ESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENLRFDKREKKNDPAFCEELAALG
PF00162         EKYSLKPVAERLSELLGKPVKFADDCVGPEVEAAVAALKPGEVLLLENVRFYKEEEKNDEAFAKKLASLG


                         +         .         .         .         .         *         .:210
query           EAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVATLSGMLEEPRRPFTAILGGSKVSDKIKVIDAL
PF00162         DVYVNDAFGTAHRAHASTVGIAKFLPAAAGFLMEKELEALGKALENPERPFVAIVGGAKVSDKIGVIENL


                         .         .         .         +         .         .         .:280
query           MDKCDTLIIGGGMCFTFLLAQGKAVGTSLKEEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAET
PF00162         LDKVDKLIIGGGMANTFLKAQGYEIGKSLVEEDKVELAKELLEKAKARGVKILLPVDVVVADEFSADAEA


                         .         *         .         .         .         .         +:350
query           LTVSVDGIPGDMMGLDIGPETAKLYADAVAQAKTVFWNGPMGVFEMKAFXXXXXXXXXXXXXXXXXXXII
PF00162         KVVEVDAIPDGWMGLDIGPKTIELFAEAIKNAKTIVWNGPMGVFEFDPFAKGTKAVAKAIAESKGAFSII


                         .         .         .         .         *         .         .:420
query           GGGDSVAAVNKFDLAEQMTFISTGGGASMELVQGExxxxxxxxx
PF00162         GGGDTAAAVEKLGLADKFSHISTGGGASLELLEGK---------