[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55893.1

[Show Plain Result]


## Summary of Sequence Search
    1::501
    1::145     2e-20  37%  146 aa  PF05697 Trigger_N "Bacterial trigger factor protein (TF)"
    1::156     8e-12  31%  161 aa  PF05698 Trigger_C "Bacterial trigger factor protein (TF)
    1::501

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxVETKVEALEDNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGAEAVR
PF05697         ------MQVTVEKLEGLKVKLTVEVPAEEIEKAVDKALKKLAKKVKIPGFRKGKVPRSIIEKRYGKSAVR
PF05698         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVTVKPEIEISSYEPVEIELPAEGT
PF05697         AEALNELLQEAYEEAVKEENLRPVGQPEIEPKEF-EPGEDLEFTATVEVYPEVELGDYKGLEVEKPVVEV
PF05698         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TDAEIDEQIDALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05697         TDEDVDEELERL----------------------------------------------------------
PF05698         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEDL
PF05697         ----------------------------------------------------------------------
PF05698         ------------------------------------------------------------------LEEL


                         .         *         .         .         .         .         +:350
query           RARIAESVTSQKADMMPRLKENACLYALAERVEGDVPEAMLEDAEASLIQDFFQQLQSQGMTFDVYLAQQ
PF05697         ----------------------------------------------------------------------
PF05698         KAKIKENLEEEKEQAADQKLKNAVLDALVENTEIDLPEALVEQEIDRLLEQFEQQLQQQGLDLEQYLQFT


                         .         .         .         .         *         .         .:420
query           GITPDQFKEDVKKQAEDMSKQDLALDAWARHFGMXXXXXXXXXXXXKSGVEDPAALEAEWRSNGQLHMVR
PF05697         ----------------------------------------------------------------------
PF05698         GTTEEELREEFEEQAEKRVKLGLILEEIAKKEKIEVTDEEVKAEIEEMAKQDPEEVKEFLKKNGQLDELK


                         .         .         +         .         .         .         .:490
query           QGVIRTKAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05697         ----------------------------------------------------------------------
PF05698         ADILEEKAV-------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxx
PF05697         -----------
PF05698         -----------