[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV55970.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
    8::99      8e-19  46%   99 aa  PF02410 DUF143 "Domain of unknown function DUF143"
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIIDEIEDAVRTKA
PF02410         -------------------ALDDKKAEDIVVLDLRGKSSITDYMIIATGRSERHVRAIADELRRKLKEAG


                         .         .         *         .         .         .         .:140
query           QMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02410         KLPP-RVEGLGEGDWVLVDLGDVVVHVFTEEAREFYDLEKLW----------------------------


                         +         .         .         .         .         *         .:210
query           xx
PF02410         --