[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56026.1

[Show Plain Result]


## Summary of Sequence Search
    1::278
    1::246     1e-37  41%  246 aa  PF02110 HK "Hydroxyethylthiazole kinase family"
    1::278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICGGLTLNIGTLN
PF02110         ---------VEKVREKNPLVHCITNYVVANFTANVLLALGASPIMAEAPEEVEEFASIAGALVINIGTLT


                         .         .         *         .         .         .         .:140
query           ERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVVRGNMSEXXXXXXXXXXTRGV
PF02110         PERVEAMLAAGKAANENGKPVVLDPVGVGATSYRTETARELLEEGKPTVIRGNASEIAALAGETGGGKGV


                         +         .         .         .         .         *         .:210
query           DVCPGDAVTEDNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERAYAVRNGSPLMGRITGAGCMLSCVC
PF02110         D-------SGDSSEDAVEAAKQLARKYGTVVVVTGEVDYVTDGERVVVIRNGHPLMTKITGTGCLLGAVI


                         .         .         .         +         .         .         .:280
query           AAFATANPXXXXXXXXXXXXGMGLAGQIAQGRMGGYDGNGSFRTYLLDALYNLDGDxxxxxxxxxxxx
PF02110         AAFLAVEGDPLEAAVAAVLL-YGIAGELAAEK---SKGPGSFQVAFLDALYNLTDD------------