[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56092.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    1::69      2e-14  58%   69 aa  PF00298 Ribosomal_L11 "Ribosomal protein L11, RNA binding domain"
    2::60      9e-08  41%   60 aa  PF03946 Ribosomal_L11_N "Ribosomal protein L11, N-terminal
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxIKLQIXXXXXXXXXXXXXXXXXXXVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFxxx
PF00298         ----------------------------------------------------------------------
PF03946         ---------IKLQVPAGKANPAPPLGPALGPLGLNIMEFCKDFNARTKDKPGLPVPVVITVYNDRSF---


                         .         .         *         .         .         .         .:140
query           xKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRI
PF00298         -KTPPAAVLLKKAAGIEKGSGKPGKEKVGTITLKQVYEIAKIKMPDLNAKDLEGAVKSILGTARSMGITV
PF03946         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF00298         --------------------------
PF03946         --------------------------