[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56128.1

[Show Plain Result]


## Summary of Sequence Search
    1::61
   13::55      5e-10  70%   55 aa  PF00253 Ribosomal_S14 "Ribosomal protein S14p/S29e"
    1::61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxTRQHNRCTRCGRPRAYYRKFGLCRVCLRELANKGELPGVTKASx
PF00253         -----------------TRGRNRCRLTGRPRGVYRKFGLCRICFRELAHKGLIPGVKKAS-