[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56185.1

[Show Plain Result]


## Summary of Sequence Search
    1::280
    1::168     7e-19  39%  169 aa  PF01729 QRPTase_C "Quinolinate phosphoribosyl transferase,
  217::284     4e-04  33%  459 aa  PF00478 IMPDH "IMP dehydrogenase / GMP reductase domain"
    1::280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01729         ----------------------------------------------------------------------
PF00478         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVATKTRAMVDAAHAENPRCEVLTTRKSMPGAKDLL
PF01729         -----------------------------------IATATARYVDAAAGTKTR--ILDTRKTTPGLRLLE
PF00478         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQLPDIKGRCVEKKLFVEADAERARVLARAGVD
PF01729         KYAVRCGGGDNHRLGLSDAVLIKDNHIAAAGGITEAVRAAREAAPHKVKIEVEVETLEELEEALA-AGAD
PF00478         ------------------------------------------------------EDDFERAEALVEAGVD


                         .         .         .         +         .         .         .:280
query           GIQVDKVPVDELEPLVRELRAIDPHVTLIAAGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVxxxxx
PF01729         IIMLDNFSPEDLREAVKELKLLAGRVLLEASGGITLETIRAYAETGVDYISVGATHSAPALDLSL-----
PF00478         VIVIDTAHSEGVLDMIKEIKAKYPDVPVIAGNVATAEAARALIEAGADAV--------------------