[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56217.1

[Show Plain Result]


## Summary of Sequence Search
    1::295
    1::169     8e-08  30%  182 aa  PF01734 Patatin "Patatin-like phospholipase"
    1::295

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxLVFEGGGMRNSYSAGAIGVMLEQGLFFDDVYGLSAGATNAIDYVSRDARRNEASFTACLD
PF01734         ----------LVLSGGGARGAYHAGVLKALGEEGLRFDIIAGTSAGAINAALLA---AGKSPEELLELLR


                         .         .         *         .         .         .         .:140
query           DLSFRWWVMPFVDADGVGAALHGDARVRSSCALPFDFDAFQANPARVTLQAIDRDTGETVCFTRGDFPTE
PF01734         ELWLRLFFSRFRNLLGLPGGLYDGKPLEELLRELLGDTTLEDLSARLGIPRTDLDTGSAALRATDDLP-D


                         +         .         .         .         .         *         .:210
query           QTLMERVRASTSYPIVLPPTVVDGRALYDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01734         LPLADAVRASSAFPGLFPPVEIDGEWFVD-----------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01734         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxx
PF01734         ---------------